| UniProt ID | CXCL9_HUMAN | |
|---|---|---|
| UniProt AC | Q07325 | |
| Protein Name | C-X-C motif chemokine 9 | |
| Gene Name | CXCL9 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 125 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.. | |
| Protein Sequence | MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MKKSGVLFL ------CCHHHHHHH | 56.50 | 21669532 | |
| 3 | Acetylation | -----MKKSGVLFLL -----CCHHHHHHHH | 51.66 | 21669532 | |
| 4 | Phosphorylation | ----MKKSGVLFLLG ----CCHHHHHHHHH | 28.72 | 25022875 | |
| 23 | Phosphorylation | VLIGVQGTPVVRKGR HHHCCCCCCCEECCE | 8.87 | 25022875 | |
| 28 | Acetylation | QGTPVVRKGRCSCIS CCCCCEECCEEEEEE | 38.81 | 21669532 | |
| 32 | Phosphorylation | VVRKGRCSCISTNQG CEECCEEEEEECCCC | 17.08 | 29083192 | |
| 35 | Phosphorylation | KGRCSCISTNQGTIH CCEEEEEECCCCEEE | 26.15 | 29083192 | |
| 36 | Phosphorylation | GRCSCISTNQGTIHL CEEEEEECCCCEEEE | 16.20 | 29083192 | |
| 40 | Phosphorylation | CISTNQGTIHLQSLK EEECCCCEEEECCHH | 8.75 | 29083192 | |
| 45 | Phosphorylation | QGTIHLQSLKDLKQF CCEEEECCHHHHHHH | 43.69 | 29083192 | |
| 97 | Ubiquitination | EKQVSQKKKQKNGKK HHHHHHHHHHHCCCH | 53.45 | - | |
| 107 | Ubiquitination | KNGKKHQKKKVLKVR HCCCHHHHHHHHHHH | 55.04 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CXCL9_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CXCL9_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CXCL9_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PAX8_HUMAN | PAX8 | physical | 21988832 | |
| PSPC_HUMAN | SFTPC | physical | 25416956 | |
| PTN5_HUMAN | PTPN5 | physical | 25416956 | |
| KASH5_HUMAN | CCDC155 | physical | 25416956 | |
| SYNE4_HUMAN | SYNE4 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...