UniProt ID | PSPC_HUMAN | |
---|---|---|
UniProt AC | P11686 | |
Protein Name | Pulmonary surfactant-associated protein C | |
Gene Name | SFTPC | |
Organism | Homo sapiens (Human). | |
Sequence Length | 197 | |
Subcellular Localization | Secreted, extracellular space, surface film. | |
Protein Description | Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.. | |
Protein Sequence | MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Ubiquitination | --MDVGSKEVLMESP --CCCCCCEECCCCC | 46.01 | - | |
16 | Phosphorylation | LMESPPDYSAAPRGR CCCCCCCCCCCCCCC | 13.14 | 22817900 | |
28 | S-palmitoylation | RGRFGIPCCPVHLKR CCCCCCCCCHHHHHH | 3.75 | 11509324 | |
29 | S-palmitoylation | GRFGIPCCPVHLKRL CCCCCCCCHHHHHHH | 3.11 | 11509324 | |
187 | Phosphorylation | FLGMAVNTLCGEVPL HHHHHHHHHCCCCCE | 19.47 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSPC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSPC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSPC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DNJB9_HUMAN | DNAJB9 | physical | 18400946 | |
DJC10_HUMAN | DNAJC10 | physical | 18400946 | |
GRP78_HUMAN | HSPA5 | physical | 18400946 | |
PSPC_HUMAN | SFTPC | physical | 25416956 | |
SC61G_HUMAN | SEC61G | physical | 25416956 | |
SC22A_HUMAN | SEC22A | physical | 25416956 | |
TMM79_HUMAN | TMEM79 | physical | 25416956 | |
SYNE4_HUMAN | SYNE4 | physical | 25416956 | |
NPTXR_HUMAN | NPTXR | physical | 28514442 | |
CBX8_HUMAN | CBX8 | physical | 28514442 | |
CBX6_HUMAN | CBX6 | physical | 28514442 | |
SREC2_HUMAN | SCARF2 | physical | 28514442 | |
PHC2_HUMAN | PHC2 | physical | 28514442 | |
BMI1_HUMAN | BMI1 | physical | 28514442 | |
SCRB1_HUMAN | SCARB1 | physical | 28514442 | |
MFAP3_HUMAN | MFAP3 | physical | 28514442 | |
MPZL1_HUMAN | MPZL1 | physical | 28514442 | |
E2AK3_HUMAN | EIF2AK3 | physical | 28514442 | |
VPP2_HUMAN | ATP6V0A2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
610913 | Pulmonary surfactant metabolism dysfunction 2 (SMDP2) | |||||
267450 | Respiratory distress syndrome in premature infants (RDS) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Palmitoylation | |
Reference | PubMed |
"Hydrophobic surfactant-associated polypeptides: SP-C is a lipopeptidewith two palmitoylated cysteine residues, whereas SP-B lackscovalently linked fatty acyl groups."; Curstedt T., Johansson J., Persson P., Eklund A., Robertson B.,Loewenadler B., Joernvall H.; Proc. Natl. Acad. Sci. U.S.A. 87:2985-2989(1990). Cited for: PALMITOYLATION AT CYS-28 AND CYS-29. | |
Phosphorylation | |
Reference | PubMed |
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer."; Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.; Cell 131:1190-1203(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-16, AND MASSSPECTROMETRY. |