UniProt ID | SC22A_HUMAN | |
---|---|---|
UniProt AC | Q96IW7 | |
Protein Name | Vesicle-trafficking protein SEC22a | |
Gene Name | SEC22A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 307 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
Protein Description | May be involved in vesicle transport between the ER and the Golgi complex.. | |
Protein Sequence | MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVGFILSLLCGALNLIRGFHAIESLLQSDGDDFNYIIAFFLGTAACLYQCYLLVYYTGWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQGKAPDYDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSMILSASV ------CCCEEEEEE | 17.96 | 22814378 | |
2 | Phosphorylation | ------MSMILSASV ------CCCEEEEEE | 17.96 | 22617229 | |
6 | Phosphorylation | --MSMILSASVIRVR --CCCEEEEEEEEEC | 13.94 | 18669648 | |
8 | Phosphorylation | MSMILSASVIRVRDG CCCEEEEEEEEECCC | 18.07 | 18669648 | |
36 | Phosphorylation | GMQECRKYFKMLSRK CHHHHHHHHHHHHHH | 6.78 | - | |
41 | Phosphorylation | RKYFKMLSRKLAQLP HHHHHHHHHHHHCCC | 24.70 | 24719451 | |
43 | Ubiquitination | YFKMLSRKLAQLPDR HHHHHHHHHHCCCCC | 44.81 | 29967540 | |
98 | Phosphorylation | QKEFITTYNMMKTNT HHHHHHHHHHHCCCC | 7.75 | - | |
134 | Phosphorylation | NNPRSLSTKINLSDM CCCCCCCCEECHHHC | 41.03 | - | |
135 | Ubiquitination | NPRSLSTKINLSDMQ CCCCCCCEECHHHCC | 26.65 | 29967540 | |
139 | Phosphorylation | LSTKINLSDMQTEIK CCCEECHHHCCCEEE | 26.92 | - | |
143 | Phosphorylation | INLSDMQTEIKLRPP ECHHHCCCEEECCCC | 32.80 | - | |
154 | Phosphorylation | LRPPYQISMCELGSA CCCCCEEEEEECCCC | 11.23 | 28787133 | |
160 | Phosphorylation | ISMCELGSANGVTSA EEEEECCCCCCCCEE | 31.05 | 28787133 | |
166 | Phosphorylation | GSANGVTSAFSVDCK CCCCCCCEEEEEECC | 25.55 | 28787133 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SC22A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SC22A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SC22A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TMM79_HUMAN | TMEM79 | physical | 25416956 | |
FATE1_HUMAN | FATE1 | physical | 25416956 | |
DTX2_HUMAN | DTX2 | physical | 25416956 | |
SYNE4_HUMAN | SYNE4 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6 AND SER-8, AND MASSSPECTROMETRY. |