UniProt ID | PAX8_HUMAN | |
---|---|---|
UniProt AC | Q06710 | |
Protein Name | Paired box protein Pax-8 | |
Gene Name | PAX8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 450 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.. | |
Protein Sequence | MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Glutathionylation | AHQGVRPCDISRQLR HHCCCCCCHHHHHHH | 5.20 | 15888455 | |
57 | Glutathionylation | QLRVSHGCVSKILGR HHHHHCHHHHHHHHC | 2.33 | 15888455 | |
59 | Phosphorylation | RVSHGCVSKILGRYY HHHCHHHHHHHHCHH | 20.32 | 22210691 | |
68 | Phosphorylation | ILGRYYETGSIRPGV HHHCHHCCCCCCCCC | 21.80 | 22210691 | |
70 | Phosphorylation | GRYYETGSIRPGVIG HCHHCCCCCCCCCCC | 23.89 | 22210691 | |
85 | Phosphorylation | GSKPKVATPKVVEKI CCCCCCCCHHHHHHH | 26.99 | 20860994 | |
126 | Phosphorylation | NDTVPSVSSINRIIR CCCCCCHHHHHHHHH | 29.82 | - | |
209 | Phosphorylation | DQDSCRLSIDSQSSS CCCCCEEEECCCCCC | 12.66 | 28857561 | |
212 | Phosphorylation | SCRLSIDSQSSSSGP CCEEEECCCCCCCCC | 30.23 | 30206219 | |
214 | Phosphorylation | RLSIDSQSSSSGPRK EEEECCCCCCCCCCH | 35.82 | 30206219 | |
215 | Phosphorylation | LSIDSQSSSSGPRKH EEECCCCCCCCCCHH | 22.38 | 24719451 | |
216 | Phosphorylation | SIDSQSSSSGPRKHL EECCCCCCCCCCHHC | 44.56 | 30206219 | |
217 | Phosphorylation | IDSQSSSSGPRKHLR ECCCCCCCCCCHHCC | 55.56 | 30206219 | |
251 | Phosphorylation | HYPEAYASPSHTKGE CCCHHHCCCCCCCCC | 17.79 | 24719451 | |
277 | Phosphorylation | TLDDGKATLTPSNTP CCCCCCCEECCCCCC | 34.35 | 24719451 | |
279 | Phosphorylation | DDGKATLTPSNTPLG CCCCCEECCCCCCCC | 21.95 | 24719451 | |
288 (in isoform 4) | Phosphorylation | - | 36.22 | 27251275 | |
290 | Phosphorylation | TPLGRNLSTHQTYPV CCCCCCCCCCCCCCE | 27.65 | 24719451 | |
291 | Phosphorylation | PLGRNLSTHQTYPVV CCCCCCCCCCCCCEE | 22.59 | 28857561 | |
297 (in isoform 4) | Phosphorylation | - | 3.79 | 27251275 | |
303 | Phosphorylation | PVVADPHSPFAIKQE CEECCCCCCCEECCC | 27.40 | 28355574 | |
304 (in isoform 4) | Phosphorylation | - | 21.47 | 27251275 | |
307 (in isoform 4) | Phosphorylation | - | 4.91 | 27251275 | |
365 (in isoform 3) | Phosphorylation | - | 41.57 | 27251275 | |
374 (in isoform 3) | Phosphorylation | - | 16.20 | 27251275 | |
381 (in isoform 3) | Phosphorylation | - | 24.62 | 27251275 | |
384 (in isoform 3) | Phosphorylation | - | 26.58 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAX8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAX8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAX8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NKX21_HUMAN | NKX2-1 | physical | 12441357 | |
KPYM_HUMAN | PKM | physical | 21988832 | |
SERC1_HUMAN | SERINC1 | physical | 20195357 | |
ANXA7_HUMAN | ANXA7 | physical | 20195357 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...