NKX21_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NKX21_HUMAN
• UniProt AC: P43699
• Protein Name: Homeobox protein Nkx-2.1
• Gene Name: NKX2-1 {ECO:0000312|HGNC:HGNC:11825}
• Organism: Homo sapiens (Human).
• Sequence Length: 371
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. Forms a regulatory loop with GRHL2 that coordinates lung epithelial cell morphogenesis and differentiation. Activates the transcription of GNRHR and plays a role in enhancing the circadian oscillation of its gene expression. Represses the transcription of the circadian transcriptional repressor NR1D1 (By similarity)..
• Protein Sequence: MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSMSPKHTT ------CCCCCCCCC	28.15	21955146
4	Phosphorylation	----MSMSPKHTTPF ----CCCCCCCCCCC	24.40	21955146
8	Phosphorylation	MSMSPKHTTPFSVSD CCCCCCCCCCCCHHH	42.14	21955146
9	Phosphorylation	SMSPKHTTPFSVSDI CCCCCCCCCCCHHHH	23.27	21955146
12	Phosphorylation	PKHTTPFSVSDILSP CCCCCCCCHHHHCHH	23.16	21955146
14	Phosphorylation	HTTPFSVSDILSPLE CCCCCCHHHHCHHHH	20.10	21955146
18	Phosphorylation	FSVSDILSPLEESYK CCHHHHCHHHHHHHH	27.98	21955146
23	Phosphorylation	ILSPLEESYKKVGME HCHHHHHHHHHHCCC	32.64	21955146
24	Phosphorylation	LSPLEESYKKVGMEG CHHHHHHHHHHCCCC	20.36	21955146
26 (in isoform 3)	Phosphorylation	-	35.47	21955146
32 (in isoform 3)	Phosphorylation	-	18.17	22210691
34 (in isoform 3)	Phosphorylation	-	6.30	22210691
41	Phosphorylation	LGAPLAAYRQGQAAP CHHHHHHHHCCCCCC	9.62	23879269
48 (in isoform 3)	Phosphorylation	-	29.77	22210691
50	Phosphorylation	QGQAAPPTAAMQQHA CCCCCCCCHHHHHHC	26.45	23879269
53 (in isoform 3)	Phosphorylation	-	3.50	22210691
54 (in isoform 3)	Phosphorylation	-	27.47	22210691
114	Phosphorylation	SASGPGWYGANPDPR CCCCCCCCCCCCCCC	16.57	-
121	Methylation	YGANPDPRFPAISRF CCCCCCCCCCHHHHH	58.52	82797527
121	Dimethylation	YGANPDPRFPAISRF CCCCCCCCCCHHHHH	58.52	-
127	Methylation	PRFPAISRFMGPASG CCCCHHHHHCCCCCC	21.32	82797535
145	Phosphorylation	SGMGGLGSLGDVSKN CCCCCCCCHHCCHHC	33.93	28857561
174	Phosphorylation	LFSQAQVYELERRFK HHHHHHHHHHHHHHH	11.61	28152594
184	Ubiquitination	ERRFKQQKYLSAPER HHHHHHHHCCCCHHH	45.74	29967540
184	Acetylation	ERRFKQQKYLSAPER HHHHHHHHCCCCHHH	45.74	15449938
214	Ubiquitination	IWFQNHRYKMKRQAK HHHHHHHHHHHHHHH	14.10	29967540
233	Phosphorylation	QQQLQQDSGGGGGGG HHHHHHHCCCCCCCC	34.69	26329039
242	Phosphorylation	GGGGGGGTGCPQQQQ CCCCCCCCCCHHHHH	38.60	26329039
254	Phosphorylation	QQQAQQQSPRRVAVP HHHHHHCCCCCEEEE	18.94	33259812
284	Phosphorylation	PGAASLQGHAQQQAQ CCHHHHHHHHHHHHH	24.32	33259812

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NKX21_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NKX21_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NKX21_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RARA_HUMAN	RARA	physical	10617585
NCOA2_HUMAN	NCOA2	physical	10617585
HIPK2_HUMAN	HIPK2	physical	11438542
CAVN1_HUMAN	PTRF	physical	9582279
NCOA3_HUMAN	NCOA3	physical	11076796
CBP_HUMAN	CREBBP	physical	11076796
TF65_HUMAN	RELA	physical	12040027
NCOA1_HUMAN	NCOA1	physical	11713256
CBP_HUMAN	CREBBP	physical	11713256

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 118700: Chorea, hereditary benign (BHC)
• 610978: Choreoathetosis and congenital hypothyroidism with or without pulmonary dysfunction (CAHTP)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.