R144B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: R144B_HUMAN
• UniProt AC: Q7Z419
• Protein Name: E3 ubiquitin-protein ligase RNF144B
• Gene Name: RNF144B
• Organism: Homo sapiens (Human).
• Sequence Length: 303
• Subcellular Localization: Mitochondrion membrane ; Single-pass membrane protein . Cytoplasm . Mostly cytosololic, accumulates in submitochondrial domains specifically upon apoptosis induction, in synchrony with BAX activation.
• Protein Description: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2, thereby promoting their degradation. Induces apoptosis via a p53/TP53-dependent but caspase-independent mechanism. However, its overexpression also produces a decrease of the ubiquitin-dependent stability of BAX, a pro-apoptotic protein, ultimately leading to protection of cell death; But, it is not an anti-apoptotic protein per se..
• Protein Sequence: MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTWCPVADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHDPSTT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	Phosphorylation	KLCLCEQSLDKMTTL CEECCCCCHHHCCCH	19.08	27251275
302	Phosphorylation	KKKHDPSTT------ CCCCCCCCC------	41.74	23911959

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of R144B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of R144B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of R144B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UB2L6_HUMAN	UBE2L6	physical	16427630
UB2L3_HUMAN	UBE2L3	physical	16427630
CDN1A_HUMAN	CDKN1A	physical	12853982
P63_HUMAN	TP63	physical	23128396

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.