UniProt ID | UB2L6_HUMAN | |
---|---|---|
UniProt AC | O14933 | |
Protein Name | Ubiquitin/ISG15-conjugating enzyme E2 L6 | |
Gene Name | UBE2L6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 153 | |
Subcellular Localization | ||
Protein Description | Catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Promotes ubiquitination and subsequent proteasomal degradation of FLT3.. | |
Protein Sequence | MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MMASMRVVKEL ----CCCCHHHHHHH | 6.82 | 25690035 | |
9 | Ubiquitination | MASMRVVKELEDLQK CCCHHHHHHHHHHHH | 54.44 | 29967540 | |
16 | Ubiquitination | KELEDLQKKPPPYLR HHHHHHHHCCCCCHH | 74.64 | 24816145 | |
17 | Ubiquitination | ELEDLQKKPPPYLRN HHHHHHHCCCCCHHC | 50.20 | 32142685 | |
26 | Phosphorylation | PPYLRNLSSDDANVL CCCHHCCCHHHHCHH | 34.96 | 25884760 | |
27 | Phosphorylation | PYLRNLSSDDANVLV CCHHCCCHHHHCHHH | 42.55 | 28450419 | |
30 | Ubiquitination | RNLSSDDANVLVWHA HCCCHHHHCHHHEEE | 17.02 | 29967540 | |
49 | Ubiquitination | DQPPYHLKAFNLRIS CCCCCEEEEEEEEEE | 37.30 | 33845483 | |
72 | Ubiquitination | PPMIKFTTKIYHPNV CCEEEEEECCCCCCC | 20.69 | 24816145 | |
96 | Ubiquitination | IISSENWKPCTKTCQ EECCCCCCCCCHHHH | 41.62 | 29967540 | |
96 | Acetylation | IISSENWKPCTKTCQ EECCCCCCCCCHHHH | 41.62 | 25953088 | |
123 | Sulfoxidation | NIREPLRMDLADLLT CCCCCCCCCHHHHHH | 6.97 | 21406390 | |
138 | Acetylation | QNPELFRKNAEEFTL HCHHHHHHCHHHHEH | 53.85 | 7662295 | |
138 | Ubiquitination | QNPELFRKNAEEFTL HCHHHHHHCHHHHEH | 53.85 | 24816145 | |
144 | Phosphorylation | RKNAEEFTLRFGVDR HHCHHHHEHHCCCCC | 21.94 | 24719451 | |
153 | Phosphorylation | RFGVDRPS------- HCCCCCCC------- | 54.47 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UB2L6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2L6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2L6_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...