| UniProt ID | RN122_HUMAN | |
|---|---|---|
| UniProt AC | Q9H9V4 | |
| Protein Name | RING finger protein 122 | |
| Gene Name | RNF122 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 155 | |
| Subcellular Localization |
Golgi apparatus . Endoplasmic reticulum . Membrane Single-pass membrane protein . |
|
| Protein Description | May induce necrosis and apoptosis. May play a role in cell viability.. | |
| Protein Sequence | MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 75 | Ubiquitination | QSERYGYKEVVLKGD HHHHHCCEEEEEECC | 39.40 | 33845483 | |
| 80 | Ubiquitination | GYKEVVLKGDAKKLQ CCEEEEEECCHHHHH | 43.04 | 32142685 | |
| 84 | Ubiquitination | VVLKGDAKKLQLYGQ EEEECCHHHHHHHCC | 59.77 | - | |
| 85 | Ubiquitination | VLKGDAKKLQLYGQT EEECCHHHHHHHCCE | 43.09 | - | |
| 94 | Ubiquitination | QLYGQTCAVCLEDFK HHHCCEEEEEHHHHC | 9.84 | 22817900 | |
| 98 | Ubiquitination | QTCAVCLEDFKGKDE CEEEEEHHHHCCCCC | 57.16 | 21890473 | |
| 103 | Ubiquitination | CLEDFKGKDELGVLP EHHHHCCCCCCCCCC | 48.93 | 32015554 | |
| 118 | Ubiquitination | CQHAFHRKCLVKWLE CCCCHHHHHHHHHHH | 24.29 | 22817900 | |
| 122 | Ubiquitination | FHRKCLVKWLEVRCV HHHHHHHHHHHHEEE | 32.87 | 21906983 | |
| 135 | Ubiquitination | CVCPMCNKPIASPSE EECCCCCCCCCCHHH | 32.64 | - | |
| 139 | Phosphorylation | MCNKPIASPSEATQN CCCCCCCCHHHHHHH | 29.67 | 25627689 | |
| 141 | Phosphorylation | NKPIASPSEATQNIG CCCCCCHHHHHHHHH | 37.05 | 25627689 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RN122_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RN122_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RN122_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RN122_HUMAN | RNF122 | physical | 20553626 | |
| CAMLG_HUMAN | CAMLG | physical | 20553626 | |
| UBE2N_HUMAN | UBE2N | physical | 20553626 | |
| UB2E1_HUMAN | UBE2E1 | physical | 20553626 | |
| UB2D1_HUMAN | UBE2D1 | physical | 20553626 | |
| UB2D2_HUMAN | UBE2D2 | physical | 20553626 | |
| UB2D3_HUMAN | UBE2D3 | physical | 20553626 | |
| DDX58_HUMAN | DDX58 | physical | 27506794 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
