UniProt ID | SEP14_HUMAN | |
---|---|---|
UniProt AC | Q6ZU15 | |
Protein Name | Septin-14 | |
Gene Name | 14-Sep | |
Organism | Homo sapiens (Human). | |
Sequence Length | 432 | |
Subcellular Localization | Cytoplasm . Cytoplasm, cytoskeleton . Colocalizes with actin stress fibers. | |
Protein Description | Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential).. | |
Protein Sequence | MAERTMAMPTQIPADGDTQKENNIRCLTTIGHFGFECLPNQLVSRSIRQGFTFNILCVGETGIGKSTLIDTLFNTNLKDNKSSHFYSNVGLQIQTYELQESNVQLKLTVVETVGYGDQIDKEASYQPIVDYIDAQFEAYLQEELKIKRSLFEYHDSRVHVCLYFISPTGHSLKSLDLLTMKNLDSKVNIIPLIAKADTISKNDLQTFKNKIMSELISNGIQIYQLPTDEETAAQANSSVSGLLPFAVVGSTDEVKVGKRMVRGRHYPWGVLQVENENHCDFVKLRDMLLCTNMENLKEKTHTQHYECYRYQKLQKMGFTDVGPNNQPVSFQEIFEAKRQEFYDQCQREEEELKQRFMQRVKEKEATFKEAEKELQDKFEHLKMIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHRKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Phosphorylation | PNQLVSRSIRQGFTF CHHHHHCHHHCCCCE | 18.02 | - | |
52 | Phosphorylation | RSIRQGFTFNILCVG CHHHCCCCEEEEEEE | 23.69 | - | |
61 | Phosphorylation | NILCVGETGIGKSTL EEEEEECCCCCHHHH | 28.33 | - | |
181 | Ubiquitination | SLDLLTMKNLDSKVN HHCCEEECCCCCCCC | 49.47 | 27667366 | |
186 | Ubiquitination | TMKNLDSKVNIIPLI EECCCCCCCCCHHHE | 38.68 | 23503661 | |
195 | Ubiquitination | NIIPLIAKADTISKN CCHHHEECCCCCCHH | 39.54 | - | |
217 | Phosphorylation | KIMSELISNGIQIYQ HHHHHHHHCCCEEEE | 41.44 | - | |
366 | Phosphorylation | RVKEKEATFKEAEKE HHHHHHHHHHHHHHH | 36.01 | - | |
368 | Ubiquitination | KEKEATFKEAEKELQ HHHHHHHHHHHHHHH | 52.22 | 30230243 | |
391 | Ubiquitination | IQQEEIRKLEEEKKQ HCHHHHHHHHHHHHH | 66.95 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEP14_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEP14_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEP14_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SEP14_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...