UniProt ID | CBR4_HUMAN | |
---|---|---|
UniProt AC | Q8N4T8 | |
Protein Name | Carbonyl reductase family member 4 | |
Gene Name | CBR4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 237 | |
Subcellular Localization | Mitochondrion matrix . | |
Protein Description | The heterotetramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity, and thereby plays a role in mitochondrial fatty acid biosynthesis. [PubMed: 19571038] | |
Protein Sequence | MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDKVCAVF -------CCCEEEEC | 11.53 | 22814378 | |
3 | Acetylation | -----MDKVCAVFGG -----CCCEEEECCC | 37.60 | 25038526 | |
11 | Phosphorylation | VCAVFGGSRGIGRAV EEEECCCCCHHHHHH | 27.93 | 29449344 | |
40 | Acetylation | ARNLEGAKAAAGDLG EECCHHHHHHCCCCC | 49.79 | - | |
51 | Ubiquitination | GDLGGDHLAFSCDVA CCCCCCEEEEECCHH | 6.48 | 22817900 | |
59 | Acetylation | AFSCDVAKEHDVQNT EEECCHHHHCHHHHH | 56.27 | 25038526 | |
63 | Ubiquitination | DVAKEHDVQNTFEEL CHHHHCHHHHHHHHH | 5.22 | 21890473 | |
96 | Acetylation | DGLLVRTKTEDMVSQ CCCEEEECCHHHHHH | 39.08 | 25038526 | |
96 | Ubiquitination | DGLLVRTKTEDMVSQ CCCEEEECCHHHHHH | 39.08 | 21890473 | |
96 (in isoform 2) | Ubiquitination | - | 39.08 | 21890473 | |
96 (in isoform 1) | Ubiquitination | - | 39.08 | 21890473 | |
98 | Ubiquitination | LLVRTKTEDMVSQLH CEEEECCHHHHHHHH | 45.74 | 21890473 | |
101 | Ubiquitination | RTKTEDMVSQLHTNL EECCHHHHHHHHHHH | 5.22 | 27667366 | |
111 | Phosphorylation | LHTNLLGSMLTCKAA HHHHHHHHHHHHHHH | 15.58 | - | |
114 | Phosphorylation | NLLGSMLTCKAAMRT HHHHHHHHHHHHHHH | 11.88 | - | |
121 | Phosphorylation | TCKAAMRTMIQQQGG HHHHHHHHHHHHCCC | 12.92 | 22210691 | |
140 (in isoform 2) | Ubiquitination | - | 50.55 | 21890473 | |
140 (in isoform 1) | Ubiquitination | - | 50.55 | 21890473 | |
140 | Ubiquitination | VGSIVGLKGNSGQSV ECCEEEEECCCCCCE | 50.55 | 21890473 | |
145 | Ubiquitination | GLKGNSGQSVYSASK EEECCCCCCEEECCC | 29.55 | 27667366 | |
150 | Ubiquitination | SGQSVYSASKGGLVG CCCCEEECCCCCHHH | 9.51 | 22817900 | |
152 | Ubiquitination | QSVYSASKGGLVGFS CCEEECCCCCHHHHH | 57.63 | 22817900 | |
152 (in isoform 2) | Ubiquitination | - | 57.63 | 21890473 | |
152 (in isoform 1) | Ubiquitination | - | 57.63 | 21890473 | |
159 | Phosphorylation | KGGLVGFSRALAKEV CCCHHHHHHHHHHHH | 15.66 | 22210691 | |
162 | Ubiquitination | LVGFSRALAKEVARK HHHHHHHHHHHHHHH | 7.32 | 21890473 | |
187 | Ubiquitination | FVHTDMTKDLKEEHL CCCCCCCHHHHHHHH | 55.19 | 21890473 | |
187 (in isoform 1) | Ubiquitination | - | 55.19 | 21890473 | |
190 | Acetylation | TDMTKDLKEEHLKKN CCCCHHHHHHHHHHC | 71.80 | 25953088 | |
190 | Ubiquitination | TDMTKDLKEEHLKKN CCCCHHHHHHHHHHC | 71.80 | 27667366 | |
195 | Acetylation | DLKEEHLKKNIPLGR HHHHHHHHHCCCCCC | 45.76 | 2380547 | |
196 | Succinylation | LKEEHLKKNIPLGRF HHHHHHHHCCCCCCH | 67.48 | 27452117 | |
197 | Ubiquitination | KEEHLKKNIPLGRFG HHHHHHHCCCCCCHH | 39.25 | 21890473 | |
200 | Ubiquitination | HLKKNIPLGRFGETI HHHHCCCCCCHHHHH | 7.33 | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CBR4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CBR4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CBR4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CBR4_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...