UniProt ID | CA109_HUMAN | |
---|---|---|
UniProt AC | Q9NX04 | |
Protein Name | Uncharacterized protein C1orf109 {ECO:0000305} | |
Gene Name | C1orf109 {ECO:0000312|HGNC:HGNC:26039} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 203 | |
Subcellular Localization | Nucleus . Cytoplasm . | |
Protein Description | May promote cancer cell proliferation by controlling the G1 to S phase transition.. | |
Protein Sequence | MTQDRPLLAVQEALKKCFPVVEEQQGLWQSALRDCQPLLSSLSNLAEQLQAAQNLRFEDVPALRAFPDLKERLRRKQLVAGDIVLDKLGERLAILLKVRDMVSSHVERVFQIYEQHADTVGIDAVLQPSAVSPSVADMLEWLQDIERHYRKSYLKRKYLLSSIQWGDLANIQALPKAWDRISKDEHQDLVQDILLNVSFFLEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Ubiquitination | LAVQEALKKCFPVVE HHHHHHHHHHHHHHH | 55.32 | - | |
16 | Ubiquitination | AVQEALKKCFPVVEE HHHHHHHHHHHHHHH | 41.79 | - | |
76 | Ubiquitination | LKERLRRKQLVAGDI HHHHHHHHHHHCCHH | 41.36 | 21890473 | |
87 | Ubiquitination | AGDIVLDKLGERLAI CCHHHHHHHHHHHHH | 54.98 | 2190698 | |
139 (in isoform 1) | Ubiquitination | - | 4.38 | 21890473 | |
150 (in isoform 1) | Ubiquitination | - | 18.47 | 21890473 | |
198 | Phosphorylation | QDILLNVSFFLEE-- HHHHHHHHHHCCC-- | 14.81 | 18452278 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CA109_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CA109_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CA109_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CEP55_HUMAN | CEP55 | physical | 25416956 | |
TRI54_HUMAN | TRIM54 | physical | 25416956 | |
ZN398_HUMAN | ZNF398 | physical | 25416956 | |
RINT1_HUMAN | RINT1 | physical | 25416956 | |
USBP1_HUMAN | USHBP1 | physical | 25416956 | |
KATL1_HUMAN | KATNAL1 | physical | 25416956 | |
LZTS2_HUMAN | LZTS2 | physical | 25416956 | |
CA094_HUMAN | C1orf94 | physical | 25416956 | |
K1C40_HUMAN | KRT40 | physical | 25416956 | |
SPERT_HUMAN | SPERT | physical | 25416956 | |
TRI42_HUMAN | TRIM42 | physical | 25416956 | |
IHO1_HUMAN | CCDC36 | physical | 25416956 | |
ZN398_HUMAN | ZNF398 | physical | 21516116 | |
TRI27_HUMAN | TRIM27 | physical | 21516116 | |
ZBED1_HUMAN | ZBED1 | physical | 21516116 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...