CA109_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CA109_HUMAN
• UniProt AC: Q9NX04
• Protein Name: Uncharacterized protein C1orf109 {ECO:0000305}
• Gene Name: C1orf109 {ECO:0000312|HGNC:HGNC:26039}
• Organism: Homo sapiens (Human).
• Sequence Length: 203
• Subcellular Localization: Nucleus . Cytoplasm .
• Protein Description: May promote cancer cell proliferation by controlling the G1 to S phase transition..
• Protein Sequence: MTQDRPLLAVQEALKKCFPVVEEQQGLWQSALRDCQPLLSSLSNLAEQLQAAQNLRFEDVPALRAFPDLKERLRRKQLVAGDIVLDKLGERLAILLKVRDMVSSHVERVFQIYEQHADTVGIDAVLQPSAVSPSVADMLEWLQDIERHYRKSYLKRKYLLSSIQWGDLANIQALPKAWDRISKDEHQDLVQDILLNVSFFLEE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Ubiquitination	LAVQEALKKCFPVVE HHHHHHHHHHHHHHH	55.32	-
16	Ubiquitination	AVQEALKKCFPVVEE HHHHHHHHHHHHHHH	41.79	-
76	Ubiquitination	LKERLRRKQLVAGDI HHHHHHHHHHHCCHH	41.36	21890473
87	Ubiquitination	AGDIVLDKLGERLAI CCHHHHHHHHHHHHH	54.98	2190698
139 (in isoform 1)	Ubiquitination	-	4.38	21890473
150 (in isoform 1)	Ubiquitination	-	18.47	21890473
198	Phosphorylation	QDILLNVSFFLEE-- HHHHHHHHHHCCC--	14.81	18452278

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CA109_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CA109_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CA109_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CEP55_HUMAN	CEP55	physical	25416956
TRI54_HUMAN	TRIM54	physical	25416956
ZN398_HUMAN	ZNF398	physical	25416956
RINT1_HUMAN	RINT1	physical	25416956
USBP1_HUMAN	USHBP1	physical	25416956
KATL1_HUMAN	KATNAL1	physical	25416956
LZTS2_HUMAN	LZTS2	physical	25416956
CA094_HUMAN	C1orf94	physical	25416956
K1C40_HUMAN	KRT40	physical	25416956
SPERT_HUMAN	SPERT	physical	25416956
TRI42_HUMAN	TRIM42	physical	25416956
IHO1_HUMAN	CCDC36	physical	25416956
ZN398_HUMAN	ZNF398	physical	21516116
TRI27_HUMAN	TRIM27	physical	21516116
ZBED1_HUMAN	ZBED1	physical	21516116

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.