UniProt ID | CDIPT_HUMAN | |
---|---|---|
UniProt AC | O14735 | |
Protein Name | CDP-diacylglycerol--inositol 3-phosphatidyltransferase | |
Gene Name | CDIPT | |
Organism | Homo sapiens (Human). | |
Sequence Length | 213 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. Cell membrane Multi-pass membrane protein. Membrane . |
|
Protein Description | Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme.. | |
Protein Sequence | MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
76 | Ubiquitination | MLTDRCSTMCLLVNL HHHHHHHHHHHHHHH | 18.61 | 21890473 | |
121 | Ubiquitination | VRGSESHKMIDLSGN HCCCCCCCEEECCCC | 46.99 | 21906983 | |
121 (in isoform 1) | Ubiquitination | - | 46.99 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDIPT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDIPT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDIPT_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RLA1_HUMAN | RPLP1 | physical | 21900206 | |
A4_HUMAN | APP | physical | 21832049 | |
SMAP2_HUMAN | SMAP2 | physical | 28514442 | |
YTHD1_HUMAN | YTHDF1 | physical | 28514442 | |
DCC1_HUMAN | DSCC1 | physical | 28514442 | |
TTC5_HUMAN | TTC5 | physical | 28514442 | |
UQCC1_HUMAN | UQCC1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...