UniProt ID | TM186_HUMAN | |
---|---|---|
UniProt AC | Q96B77 | |
Protein Name | Transmembrane protein 186 | |
Gene Name | TMEM186 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 213 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MAALLRAVRRFRGKAVWERPLHGLWCCSGQEDPKRWVGSSSPISKEKLPNAETEKFWMFYRFDAIRTFGFLSRLKLAQTALTVVALPPGYYLYSQGLLTLNTVCLMSGISGFALTMLCWMSYFLRRLVGILYLNESGTMLRVAHLNFWGWRQDTYCPMADVIPLTETKDRPQEMFVRIQRYSGKQTFYVTLRYGRILDRERFTQVFGVHQMLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Phosphorylation | DPKRWVGSSSPISKE CCCCCCCCCCCCCHH | 20.30 | - | |
40 | Phosphorylation | PKRWVGSSSPISKEK CCCCCCCCCCCCHHH | 33.92 | - | |
41 | Phosphorylation | KRWVGSSSPISKEKL CCCCCCCCCCCHHHC | 28.13 | 24719451 | |
55 | Ubiquitination | LPNAETEKFWMFYRF CCCCCCCCEEEEHHH | 52.31 | 22817900 | |
165 | Phosphorylation | MADVIPLTETKDRPQ HHHEEECCCCCCCCH | 35.93 | 29759185 | |
167 | Phosphorylation | DVIPLTETKDRPQEM HEEECCCCCCCCHHH | 32.77 | 29759185 | |
188 | Phosphorylation | YSGKQTFYVTLRYGR CCCCCEEEEEEECCE | 8.91 | 24719451 | |
190 | Phosphorylation | GKQTFYVTLRYGRIL CCCEEEEEEECCEEE | 8.30 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM186_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM186_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM186_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
POTEE_HUMAN | POTEE | physical | 28514442 | |
HEAT3_HUMAN | HEATR3 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...