| UniProt ID | TM186_HUMAN | |
|---|---|---|
| UniProt AC | Q96B77 | |
| Protein Name | Transmembrane protein 186 | |
| Gene Name | TMEM186 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 213 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MAALLRAVRRFRGKAVWERPLHGLWCCSGQEDPKRWVGSSSPISKEKLPNAETEKFWMFYRFDAIRTFGFLSRLKLAQTALTVVALPPGYYLYSQGLLTLNTVCLMSGISGFALTMLCWMSYFLRRLVGILYLNESGTMLRVAHLNFWGWRQDTYCPMADVIPLTETKDRPQEMFVRIQRYSGKQTFYVTLRYGRILDRERFTQVFGVHQMLK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 39 | Phosphorylation | DPKRWVGSSSPISKE CCCCCCCCCCCCCHH | 20.30 | - | |
| 40 | Phosphorylation | PKRWVGSSSPISKEK CCCCCCCCCCCCHHH | 33.92 | - | |
| 41 | Phosphorylation | KRWVGSSSPISKEKL CCCCCCCCCCCHHHC | 28.13 | 24719451 | |
| 55 | Ubiquitination | LPNAETEKFWMFYRF CCCCCCCCEEEEHHH | 52.31 | 22817900 | |
| 165 | Phosphorylation | MADVIPLTETKDRPQ HHHEEECCCCCCCCH | 35.93 | 29759185 | |
| 167 | Phosphorylation | DVIPLTETKDRPQEM HEEECCCCCCCCHHH | 32.77 | 29759185 | |
| 188 | Phosphorylation | YSGKQTFYVTLRYGR CCCCCEEEEEEECCE | 8.91 | 24719451 | |
| 190 | Phosphorylation | GKQTFYVTLRYGRIL CCCEEEEEEECCEEE | 8.30 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM186_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM186_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM186_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| POTEE_HUMAN | POTEE | physical | 28514442 | |
| HEAT3_HUMAN | HEATR3 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
