| UniProt ID | PIGU_HUMAN | |
|---|---|---|
| UniProt AC | Q9H490 | |
| Protein Name | Phosphatidylinositol glycan anchor biosynthesis class U protein | |
| Gene Name | PIGU | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 435 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Component of the GPI transamidase complex. May be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.. | |
| Protein Sequence | MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINNTLIAFFILTTIKGSAFLSAIFLALATYQSLYPLTLFVPGLLYLLQRQYIPVKMKSKAFWIFSWEYAMMYVGSLVVIICLSFFLLSSWDFIPAVYGFILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFYTIPLAIKLKEHPIFFMFIQIAVIAIFKSYPTVGDVALYMAFFPVWNHLYRFLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILLISDYFYAFLRREYYLTHGLYLTAKDGTEAMLVLK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 42 | Ubiquitination | VSPLSSWKRVVEGLS ECCHHHHHHHHHHCC | 36.94 | 23000965 | |
| 42 (in isoform 2) | Ubiquitination | - | 36.94 | 21890473 | |
| 42 (in isoform 1) | Ubiquitination | - | 36.94 | 21890473 | |
| 91 (in isoform 2) | Ubiquitination | - | 20.10 | 21890473 | |
| 108 | Ubiquitination | DFNKVVFKKQKLLLE CHHHHHHHHHHHHHH | 42.56 | 22817900 | |
| 109 | Ubiquitination | FNKVVFKKQKLLLEL HHHHHHHHHHHHHHH | 41.00 | 22817900 | |
| 111 | Ubiquitination | KVVFKKQKLLLELDQ HHHHHHHHHHHHHHH | 50.40 | 22817900 | |
| 111 (in isoform 1) | Ubiquitination | - | 50.40 | 21890473 | |
| 216 | Ubiquitination | QRQYIPVKMKSKAFW HHCCCCCCCCCCEEE | 34.94 | 27667366 | |
| 421 | Phosphorylation | YYLTHGLYLTAKDGT HHHHCCEEEEECCCC | 13.44 | 27642862 | |
| 431 | Sulfoxidation | AKDGTEAMLVLK--- ECCCCEEEEEEC--- | 1.85 | 21406390 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIGU_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIGU_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIGU_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| STOM_HUMAN | STOM | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
