UniProt ID | COX16_HUMAN | |
---|---|---|
UniProt AC | Q9P0S2 | |
Protein Name | Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial {ECO:0000305} | |
Gene Name | COX16 {ECO:0000303|PubMed:29355485, ECO:0000303|PubMed:29381136, ECO:0000312|HGNC:HGNC:20213} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 106 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
Protein Description | Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. [PubMed: 29355485] | |
Protein Sequence | MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Acetylation | AVMRAFRKNKTLGYG HHHHHHHHCCCCCCC | 57.24 | 7932693 | |
41 | Phosphorylation | REFSQIRYDAVKSKM HHHHHHHHHHHHHHC | 15.19 | - | |
45 | Ubiquitination | QIRYDAVKSKMDPEL HHHHHHHHHHCCHHH | 46.19 | 29967540 | |
65 | Phosphorylation | ENKISLESEYEKIKD HCCCCHHHHHHHHHC | 51.26 | 28796482 | |
67 | Phosphorylation | KISLESEYEKIKDSK CCCHHHHHHHHHCCC | 31.62 | 28796482 | |
69 | Ubiquitination | SLESEYEKIKDSKFD CHHHHHHHHHCCCCC | 54.90 | 29967540 | |
74 | Acetylation | YEKIKDSKFDDWKNI HHHHHCCCCCCCCCC | 64.05 | 7972735 | |
79 | Acetylation | DSKFDDWKNIRGPRP CCCCCCCCCCCCCCC | 49.87 | 7972745 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX16_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX16_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX16_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of COX16_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...