UniProt ID | MTFP1_HUMAN | |
---|---|---|
UniProt AC | Q9UDX5 | |
Protein Name | Mitochondrial fission process protein 1 | |
Gene Name | MTFP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 166 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function induces the release of cytochrome c, which activates the caspase cascade and leads to apoptosis.. | |
Protein Sequence | MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
74 | Phosphorylation | PSPEAGRSARVTVAV CCHHCCCCCCEEEEE | 21.36 | - | |
78 | Phosphorylation | AGRSARVTVAVVDTF CCCCCCEEEEEEEHH | 9.37 | - | |
123 | Succinylation | RWPLAVRKWTTTALG CCCCHHHHHHHHHHH | 42.15 | - | |
123 | Succinylation | RWPLAVRKWTTTALG CCCCHHHHHHHHHHH | 42.15 | - | |
157 | Phosphorylation | DSSLRKLYPTVGKPS CHHHHHHCCCCCCCC | 10.41 | 29496907 | |
159 | Phosphorylation | SLRKLYPTVGKPSSS HHHHHCCCCCCCCCC | 28.47 | 29083192 | |
162 | Ubiquitination | KLYPTVGKPSSS--- HHCCCCCCCCCC--- | 37.07 | - | |
164 | Phosphorylation | YPTVGKPSSS----- CCCCCCCCCC----- | 46.85 | 29083192 | |
165 | Phosphorylation | PTVGKPSSS------ CCCCCCCCC------ | 48.90 | 29083192 | |
166 | Phosphorylation | TVGKPSSS------- CCCCCCCC------- | 48.88 | 29083192 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTFP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTFP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTFP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MTFP1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...