| UniProt ID | MARC1_HUMAN | |
|---|---|---|
| UniProt AC | Q5VT66 | |
| Protein Name | Mitochondrial amidoxime-reducing component 1 | |
| Gene Name | 1-Mar | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 337 | |
| Subcellular Localization |
Mitochondrion outer membrane Single-pass type II membrane protein . Membrane Lipid-anchor . Mitochondrial import is mediated by AA 1-40 and requires ATP. |
|
| Protein Description | As a component of an N-hydroxylated prodrug-converting complex required to reduce N-hydroxylated prodrugs, such as benzamidoxime. Also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine, respectively.. | |
| Protein Sequence | MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGAAGSSAL ------CCCCHHHHH | 25807930 | ||
| 6 | Phosphorylation | --MGAAGSSALARFV --CCCCHHHHHHHHH | 20068231 | ||
| 7 | Phosphorylation | -MGAAGSSALARFVL -CCCCHHHHHHHHHH | 20068231 | ||
| 18 | Phosphorylation | RFVLLAQSRPGWLGV HHHHHHHCCCCHHHH | 20068231 | ||
| 46 | Ubiquitination | AWRRAWPTRRRRLLQ HHHHHCHHHHHHHHH | 21963094 | ||
| 65 | Ubiquitination | VAQLWIYPVKSCKGV EEEEEEEECCCCCCC | 21963094 | ||
| 67 | Malonylation | QLWIYPVKSCKGVPV EEEEEECCCCCCCCC | 26320211 | ||
| 67 | Acetylation | QLWIYPVKSCKGVPV EEEEEECCCCCCCCC | 26051181 | ||
| 67 | Ubiquitination | QLWIYPVKSCKGVPV EEEEEECCCCCCCCC | 21963094 | ||
| 70 | Ubiquitination | IYPVKSCKGVPVSEA EEECCCCCCCCCCHH | 21963094 | ||
| 72 | Ubiquitination | PVKSCKGVPVSEAEC ECCCCCCCCCCHHHH | 21963094 | ||
| 91 | Ubiquitination | LRSGNLRDRFWLVIN CCCCCCCCCEEEEEE | 21963094 | ||
| 100 | Ubiquitination | FWLVINQEGNMVTAR EEEEEECCCCEEECC | 21963094 | ||
| 111 | Methylation | VTARQEPRLVLISLT EECCCCCCEEEEEEE | 54557407 | ||
| 119 | Ubiquitination | LVLISLTCDGDTLTL EEEEEEEECCCEEEE | 21963094 | ||
| 139 | Ubiquitination | KDLLLPIKTPTTNAV CCCEEECCCCCCCCC | 29967540 | ||
| 140 | Phosphorylation | DLLLPIKTPTTNAVH CCEEECCCCCCCCCC | 25159151 | ||
| 148 | Ubiquitination | PTTNAVHKCRVHGLE CCCCCCCCCEECCEE | 21963094 | ||
| 163 | Ubiquitination | IEGRDCGEATAQWIT EECCCCHHHHHHHHH | 21963094 | ||
| 171 | Phosphorylation | ATAQWITSFLKSQPY HHHHHHHHHHHCCCE | 24719451 | ||
| 174 | Ubiquitination | QWITSFLKSQPYRLV HHHHHHHHCCCEEEE | 21963094 | ||
| 180 | Ubiquitination | LKSQPYRLVHFEPHM HHCCCEEEEEECCCC | 22817900 | ||
| 182 | Ubiquitination | SQPYRLVHFEPHMRP CCCEEEEEECCCCCC | 21963094 | ||
| 186 | Ubiquitination | RLVHFEPHMRPRRPH EEEEECCCCCCCCCC | 21963094 | ||
| 193 | Ubiquitination | HMRPRRPHQIADLFR CCCCCCCCHHHHHCC | 21963094 | ||
| 199 | Ubiquitination | PHQIADLFRPKDQIA CCHHHHHCCCHHHCC | 22817900 | ||
| 202 | Ubiquitination | IADLFRPKDQIAYSD HHHHCCCHHHCCCCC | 21963094 | ||
| 202 (in isoform 2) | Ubiquitination | - | - | ||
| 203 | Ubiquitination | ADLFRPKDQIAYSDT HHHCCCHHHCCCCCC | 21963094 | ||
| 204 | Ubiquitination | DLFRPKDQIAYSDTS HHCCCHHHCCCCCCC | 21963094 | ||
| 205 | Ubiquitination | LFRPKDQIAYSDTSP HCCCHHHCCCCCCCC | 21963094 | ||
| 208 | Ubiquitination | PKDQIAYSDTSPFLI CHHHCCCCCCCCEEE | 21890473 | ||
| 210 | Ubiquitination | DQIAYSDTSPFLILS HHCCCCCCCCEEEEE | 21963094 | ||
| 212 | Ubiquitination | IAYSDTSPFLILSEA CCCCCCCCEEEEEHH | 21963094 | ||
| 221 | Ubiquitination | LILSEASLADLNSRL EEEEHHHHHHHHHHH | 21963094 | ||
| 222 | Ubiquitination | ILSEASLADLNSRLE EEEHHHHHHHHHHHH | 21963094 | ||
| 223 | Ubiquitination | LSEASLADLNSRLEK EEHHHHHHHHHHHHH | 21963094 | ||
| 225 (in isoform 3) | Ubiquitination | - | 21890473 | ||
| 225 | Ubiquitination | EASLADLNSRLEKKV HHHHHHHHHHHHHHH | 21890473 | ||
| 227 | Ubiquitination | SLADLNSRLEKKVKA HHHHHHHHHHHHHHH | 21890473 | ||
| 229 | Ubiquitination | ADLNSRLEKKVKATN HHHHHHHHHHHHHCC | 21963094 | ||
| 230 | Ubiquitination | DLNSRLEKKVKATNF HHHHHHHHHHHHCCC | 29967540 | ||
| 240 | Ubiquitination | KATNFRPNIVISGCD HHCCCCCCEEEECCE | 21963094 | ||
| 242 | Ubiquitination | TNFRPNIVISGCDVY CCCCCCEEEECCEEE | 22817900 | ||
| 244 | Ubiquitination | FRPNIVISGCDVYAE CCCCEEEECCEEEEC | 21890473 | ||
| 261 | Ubiquitination | WDELLIGDVELKRVM CCCCEECCHHHHHHH | 22817900 | ||
| 265 | Ubiquitination | LIGDVELKRVMACSR EECCHHHHHHHCCCC | 21963094 | ||
| 271 | Phosphorylation | LKRVMACSRCILTTV HHHHHCCCCEEEEEE | 22210691 | ||
| 276 | Phosphorylation | ACSRCILTTVDPDTG CCCCEEEEEECCCCC | 22210691 | ||
| 277 | Phosphorylation | CSRCILTTVDPDTGV CCCEEEEEECCCCCC | 22210691 | ||
| 282 | Ubiquitination | LTTVDPDTGVMSRKE EEEECCCCCCCCCCC | 22817900 | ||
| 288 | Ubiquitination | DTGVMSRKEPLETLK CCCCCCCCCCHHHHH | 21963094 | ||
| 295 | Ubiquitination | KEPLETLKSYRQCDP CCCHHHHHHHHCCCH | 21963094 | ||
| 296 | Phosphorylation | EPLETLKSYRQCDPS CCHHHHHHHHCCCHH | - | ||
| 297 | Phosphorylation | PLETLKSYRQCDPSE CHHHHHHHHCCCHHH | - | ||
| 303 | Phosphorylation | SYRQCDPSERKLYGK HHHCCCHHHHHHHCC | - | ||
| 305 | Ubiquitination | RQCDPSERKLYGKSP HCCCHHHHHHHCCCC | 21963094 | ||
| 306 | Ubiquitination | QCDPSERKLYGKSPL CCCHHHHHHHCCCCC | 21963094 | ||
| 310 | Ubiquitination | SERKLYGKSPLFGQY HHHHHHCCCCCCCCE | 21890473 | ||
| 310 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 310 | Ubiquitination | SERKLYGKSPLFGQY HHHHHHCCCCCCCCE | 21963094 | ||
| 312 | Ubiquitination | RKLYGKSPLFGQYFV HHHHCCCCCCCCEEE | 21963094 | ||
| 312 (in isoform 2) | Ubiquitination | - | - | ||
| 317 | Phosphorylation | KSPLFGQYFVLENPG CCCCCCCEEEEECCC | - | ||
| 323 | Ubiquitination | QYFVLENPGTIKVGD CEEEEECCCEEECCC | 21963094 | ||
| 327 | Ubiquitination | LENPGTIKVGDPVYL EECCCEEECCCCEEE | 21890473 | ||
| 344 | Ubiquitination | Q-------------- C-------------- | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MARC1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MARC1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MARC1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RAB6C_HUMAN | RAB6C | physical | 22939629 | |
| RM39_HUMAN | MRPL39 | physical | 22939629 | |
| VATB1_HUMAN | ATP6V1B1 | physical | 22939629 | |
| NDUBA_HUMAN | NDUFB10 | physical | 22939629 | |
| NDUB4_HUMAN | NDUFB4 | physical | 22939629 | |
| ZC3H4_HUMAN | ZC3H4 | physical | 22939629 | |
| NDUS4_HUMAN | NDUFS4 | physical | 22939629 | |
| RM15_HUMAN | MRPL15 | physical | 22939629 | |
| S2546_HUMAN | SLC25A46 | physical | 22939629 | |
| ODPX_HUMAN | PDHX | physical | 22939629 | |
| TFB2M_HUMAN | TFB2M | physical | 27173435 | |
| MCATL_HUMAN | SLC25A29 | physical | 27173435 | |
| AGM1_HUMAN | PGM3 | physical | 27173435 | |
| MBB1A_HUMAN | MYBBP1A | physical | 27173435 | |
| BDH_HUMAN | BDH1 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
