PACRG_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PACRG_HUMAN
• UniProt AC: Q96M98
• Protein Name: Parkin coregulated gene protein
• Gene Name: PACRG
• Organism: Homo sapiens (Human).
• Sequence Length: 296
• Protein Description: Suppresses cell death induced by accumulation of unfolded Pael receptor (Pael-R, a substrate of Parkin). Facilitates the formation of inclusions consisting of Pael-R, molecular chaperones, protein degradation molecules and itself when proteasome is inhibited. May play an important role in the formation of Lewy bodies and protection of dopaminergic neurons against Parkinson disease..
• Protein Sequence: MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNGSYSLPRLECSGAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MVAEKETLSLNKCP -CCCCCCCCCCCCCC	32.49	30622161
9	Phosphorylation	VAEKETLSLNKCPDK CCCCCCCCCCCCCCC	37.00	30622161
36	Phosphorylation	LPVHQPHSLVSEGFT CCCCCCCCHHCCCCC	36.83	25693802
39	Phosphorylation	HQPHSLVSEGFTVKA CCCCCHHCCCCCEEE	36.98	25693802
43	Phosphorylation	SLVSEGFTVKAMMKN CHHCCCCCEEEHHCC	31.77	25693802
68	Ubiquitination	AFKERPTKPTAFRKF CCCCCCCCCCCHHHH	42.95	22505724
160	Methylation	IKNALNLRNRQVICV CCCHHCCCCCEEEEE	34.90	115486313
190	Phosphorylation	GKALVPYYRQILPVL HHHHHHHHHHHHHHH	7.03	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	SYVN1	Q86TM6	PMID:15572843

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PACRG_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PACRG_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HS90A_HUMAN	HSP90AA1	physical	14532270
TCPG_HUMAN	CCT3	physical	14532270
TCPD_HUMAN	CCT4	physical	14532270
TCPE_HUMAN	CCT5	physical	14532270
TCPA_HUMAN	TCP1	physical	14532270
TCPZ_HUMAN	CCT6A	physical	14532270
TCPH_HUMAN	CCT7	physical	14532270
TCPB_HUMAN	CCT2	physical	14532270
TBA1A_HUMAN	TUBA1A	physical	14532270
TBB5_HUMAN	TUBB	physical	14532270
HSP74_HUMAN	HSPA4	physical	14532270
PRKN_HUMAN	PARK2	physical	14532270
CHIP_HUMAN	STUB1	physical	14532270
DNJA1_HUMAN	DNAJA1	physical	14532270
TERA_HUMAN	VCP	physical	14532270
A4_HUMAN	APP	physical	21832049
KLH36_HUMAN	KLHL36	physical	26186194
STIP1_HUMAN	STIP1	physical	14532270
KLH36_HUMAN	KLHL36	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.