UniProt ID | PIP_HUMAN | |
---|---|---|
UniProt AC | P12273 | |
Protein Name | Prolactin-inducible protein | |
Gene Name | PIP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 146 | |
Subcellular Localization | Secreted. | |
Protein Description | ||
Protein Sequence | MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Pyrrolidone_carboxylic_acid | QLGANKAQDNTRKII HHCCCCCCCCCCEEE | 46.20 | - | |
29 | Pyrrolidone_carboxylic_acid | QLGANKAQDNTRKII HHCCCCCCCCCCEEE | 46.20 | 2013294 | |
29 | Pyrrolidone_carboxylic_acid | QLGANKAQDNTRKII HHCCCCCCCCCCEEE | 46.20 | 2013294 | |
45 | Phosphorylation | KNFDIPKSVRPNDEV ECCCCCCCCCCCCCH | 20.29 | 20068231 | |
53 | Phosphorylation | VRPNDEVTAVLAVQT CCCCCCHHEEEEEEE | 14.70 | 20068231 | |
60 | Phosphorylation | TAVLAVQTELKECMV HEEEEEEECHHHCCE | 36.36 | 20068231 | |
84 | Phosphorylation | PLQGAFNYKYTACLC CCCCCCCCEEEEEEE | 10.02 | 22817900 | |
105 | N-linked_Glycosylation | FYWDFYTNRTVQIAA EEEEECCCCEEHHHH | 26.67 | 18930737 | |
105 | N-linked_Glycosylation | FYWDFYTNRTVQIAA EEEEECCCCEEHHHH | 26.67 | 18780401 | |
139 | Phosphorylation | IKNNRFYTIEILKVE EECCEEEEEEEEEEC | 14.93 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PIP_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from humanseminal plasma."; Hassan M.I., Bilgrami S., Kumar V., Singh N., Yadav S., Kaur P.,Singh T.P.; J. Mol. Biol. 384:663-672(2008). Cited for: X-RAY CRYSTALLOGRAPHY (3.2 ANGSTROMS) OF 29-146 IN COMPLEX WITH AZGP1,DISULFIDE BONDS, AND GLYCOSYLATION AT ASN-105. | |
"Identification of N-linked glycoproteins in human milk by hydrophilicinteraction liquid chromatography and mass spectrometry."; Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F.; Proteomics 8:3833-3847(2008). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105, AND MASSSPECTROMETRY. | |
"Identification of N-linked glycoproteins in human saliva byglycoprotein capture and mass spectrometry."; Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T.,Loo J.A.; J. Proteome Res. 5:1493-1503(2006). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105, AND MASSSPECTROMETRY. | |
"Primary structure of a new actin-binding protein from human seminalplasma."; Schaller J., Akiyama K., Kimura H., Hess D., Affolter M., Rickli E.E.; Eur. J. Biochem. 196:743-750(1991). Cited for: PROTEIN SEQUENCE OF 29-146, DISULFIDE BONDS, AND GLYCOSYLATION ATASN-105. | |
Pyrrolidone carboxylic acid | |
Reference | PubMed |
"Primary structure of a new actin-binding protein from human seminalplasma."; Schaller J., Akiyama K., Kimura H., Hess D., Affolter M., Rickli E.E.; Eur. J. Biochem. 196:743-750(1991). Cited for: PROTEIN SEQUENCE OF 29-146, DISULFIDE BONDS, AND GLYCOSYLATION ATASN-105. |