| UniProt ID | NTPCR_HUMAN | |
|---|---|---|
| UniProt AC | Q9BSD7 | |
| Protein Name | Cancer-related nucleoside-triphosphatase | |
| Gene Name | NTPCR | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 190 | |
| Subcellular Localization | ||
| Protein Description | Has nucleotide phosphatase activity towards ATP, GTP, CTP, TTP and UTP. Hydrolyzes nucleoside diphosphates with lower efficiency.. | |
| Protein Sequence | MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MARHVFLTG ------CCCEEEECC | 15.41 | 19413330 | |
| 8 | Phosphorylation | MARHVFLTGPPGVGK CCCEEEECCCCCCCH | 35.86 | 23532336 | |
| 15 | Acetylation | TGPPGVGKTTLIHKA CCCCCCCHHHHHHHH | 35.61 | 25953088 | |
| 15 | Ubiquitination | TGPPGVGKTTLIHKA CCCCCCCHHHHHHHH | 35.61 | - | |
| 21 | Acetylation | GKTTLIHKASEVLKS CHHHHHHHHHHHHHH | 46.76 | 19608861 | |
| 21 | Ubiquitination | GKTTLIHKASEVLKS CHHHHHHHHHHHHHH | 46.76 | 21890473 | |
| 27 | Ubiquitination | HKASEVLKSSGVPVD HHHHHHHHHCCCCCC | 47.99 | - | |
| 37 | Phosphorylation | GVPVDGFYTEEVRQG CCCCCCEEHHHHHCC | 20.83 | 28796482 | |
| 38 | Phosphorylation | VPVDGFYTEEVRQGG CCCCCEEHHHHHCCC | 24.33 | 28796482 | |
| 54 | Phosphorylation | RIGFDVVTLSGTRGP EEEEEEEEECCCCCC | 18.30 | 20068231 | |
| 56 | Phosphorylation | GFDVVTLSGTRGPLS EEEEEEECCCCCCHH | 28.84 | 20068231 | |
| 58 | Phosphorylation | DVVTLSGTRGPLSRV EEEEECCCCCCHHHC | 29.13 | 20068231 | |
| 73 | Acetylation | GLEPPPGKRECRVGQ CCCCCCCCCCCCCCC | 51.28 | 25953088 | |
| 73 | Ubiquitination | GLEPPPGKRECRVGQ CCCCCCCCCCCCCCC | 51.28 | - | |
| 102 | Phosphorylation | VLRNADCSSGPGQRV HHHCCCCCCCCCCEE | 38.59 | 21406692 | |
| 103 | Phosphorylation | LRNADCSSGPGQRVC HHCCCCCCCCCCEEE | 56.17 | 21406692 | |
| 135 | Phosphorylation | AVRQTLSTPGTIILG HHHHHCCCCCEEEEE | 28.93 | 24719451 | |
| 148 | Ubiquitination | LGTIPVPKGKPLALV EEEEECCCCCCCHHH | 78.70 | 21890473 | |
| 150 | Ubiquitination | TIPVPKGKPLALVEE EEECCCCCCCHHHHH | 42.88 | - | |
| 150 | Malonylation | TIPVPKGKPLALVEE EEECCCCCCCHHHHH | 42.88 | 26320211 | |
| 165 | Ubiquitination | IRNRKDVKVFNVTKE HHCCCCCEEEEECCC | 51.77 | 21890473 | |
| 165 | Acetylation | IRNRKDVKVFNVTKE HHCCCCCEEEEECCC | 51.77 | 19608861 | |
| 165 | Malonylation | IRNRKDVKVFNVTKE HHCCCCCEEEEECCC | 51.77 | 26320211 | |
| 170 | Phosphorylation | DVKVFNVTKENRNHL CCEEEEECCCCCCCC | 33.47 | - | |
| 171 | Acetylation | VKVFNVTKENRNHLL CEEEEECCCCCCCCC | 49.02 | 25953088 | |
| 171 | Ubiquitination | VKVFNVTKENRNHLL CEEEEECCCCCCCCC | 49.02 | 21890473 | |
| 171 | Malonylation | VKVFNVTKENRNHLL CEEEEECCCCCCCCC | 49.02 | 26320211 | |
| 184 | Glutathionylation | LLPDIVTCVQSSRK- CCHHHHHHHHHCCC- | 1.49 | 22555962 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NTPCR_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NTPCR_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NTPCR_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| STABP_HUMAN | STAMBP | physical | 21988832 | |
| WDR19_HUMAN | WDR19 | physical | 27173435 | |
| WDR35_HUMAN | WDR35 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-21 AND LYS-165, AND MASSSPECTROMETRY. | |