UniProt ID | UB2E3_HUMAN | |
---|---|---|
UniProt AC | Q969T4 | |
Protein Name | Ubiquitin-conjugating enzyme E2 E3 | |
Gene Name | UBE2E3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 207 | |
Subcellular Localization | Nucleus . Cytoplasm . Shuttles between the nucleus and cytoplasm in a IPO11-dependent manner. | |
Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest.. | |
Protein Sequence | MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSDRQRSD ------CCCCCCCCC | 40.73 | 28450419 | |
2 | Acetylation | ------MSSDRQRSD ------CCCCCCCCC | 40.73 | 19413330 | |
3 | Phosphorylation | -----MSSDRQRSDD -----CCCCCCCCCC | 35.20 | 28450419 | |
8 | Phosphorylation | MSSDRQRSDDESPST CCCCCCCCCCCCCCC | 40.87 | 29255136 | |
12 | Phosphorylation | RQRSDDESPSTSSGS CCCCCCCCCCCCCCC | 31.01 | 22167270 | |
14 | Phosphorylation | RSDDESPSTSSGSSD CCCCCCCCCCCCCCC | 50.64 | 22167270 | |
15 | Phosphorylation | SDDESPSTSSGSSDA CCCCCCCCCCCCCCH | 30.23 | 22167270 | |
16 | Phosphorylation | DDESPSTSSGSSDAD CCCCCCCCCCCCCHH | 36.72 | 23927012 | |
17 | Phosphorylation | DESPSTSSGSSDADQ CCCCCCCCCCCCHHH | 42.66 | 23927012 | |
19 | Phosphorylation | SPSTSSGSSDADQRD CCCCCCCCCCHHHCC | 27.30 | 23927012 | |
20 | Phosphorylation | PSTSSGSSDADQRDP CCCCCCCCCHHHCCC | 40.10 | 23927012 | |
39 | Ubiquitination | PEEQEERKPSATQQK HHHHHHHCCCHHHHH | 46.75 | - | |
58 | Ubiquitination | LSSKTTAKLSTSAKR CCHHHHHHHHHHHHH | 40.66 | - | |
58 | Acetylation | LSSKTTAKLSTSAKR CCHHHHHHHHHHHHH | 40.66 | 25953088 | |
60 | Phosphorylation | SKTTAKLSTSAKRIQ HHHHHHHHHHHHHHH | 21.43 | 28348404 | |
68 | Ubiquitination | TSAKRIQKELAEITL HHHHHHHHHHHHCCC | 52.93 | - | |
86 | Ubiquitination | PNCSAGPKGDNIYEW CCCCCCCCCCCEEEE | 77.35 | - | |
91 | Phosphorylation | GPKGDNIYEWRSTIL CCCCCCEEEECCCEE | 18.72 | 21082442 | |
150 | Ubiquitination | VICLDILKDNWSPAL EEEEHHHCCCCCCCH | 49.72 | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UB2E3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UB2E3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UB2E3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-3, AND MASSSPECTROMETRY. | |
"Large-scale characterization of HeLa cell nuclear phosphoproteins."; Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J.,Li J., Cohn M.A., Cantley L.C., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12, AND MASSSPECTROMETRY. |