| UniProt ID | PCGF3_HUMAN | |
|---|---|---|
| UniProt AC | Q3KNV8 | |
| Protein Name | Polycomb group RING finger protein 3 | |
| Gene Name | PCGF3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 242 | |
| Subcellular Localization | Nucleus . Nucleus, nucleoplasm . Recruited by the non-coding RNA Xist to specific nuclear foci that probably correspond to the inactivated X chromosome. | |
| Protein Description | Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Within the PRC1-like complex, regulates RNF2 ubiquitin ligase activity. [PubMed: 26151332 Plays a redundant role with PCGF5 as part of a PRC1-like complex that mediates monoubiquitination of histone H2A 'Lys-119' on the X chromosome and is required for normal silencing of one copy of the X chromosome in XX females (By similarity] | |
| Protein Sequence | MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | Phosphorylation | CLHTFCRSCLVKYLE HHHHHHHHHHHHHHH | 17.00 | 24719451 | |
| 73 | Phosphorylation | QYIGHDRTMQDIVYK HHCCCCCCHHHHHHH | 25.82 | 25690035 | |
| 79 | Phosphorylation | RTMQDIVYKLVPGLQ CCHHHHHHHHCCCHH | 10.03 | 22817900 | |
| 99 | Ubiquitination | KQREFYHKLGMEVPG HHHHHHHHCCCCCCC | 35.04 | - | |
| 104 (in isoform 2) | Ubiquitination | - | 4.82 | - | |
| 116 | Acetylation | KGETCSAKQHLDSHR CCCCCCCHHHHHHCC | 23.20 | 7670035 | |
| 116 | Ubiquitination | KGETCSAKQHLDSHR CCCCCCCHHHHHHCC | 23.20 | - | |
| 132 | Phosphorylation | GETKADDSSNKEAAE CCCCCCCCCCHHHHH | 36.04 | 24260401 | |
| 148 | Phosphorylation | KPEEDNDYHRSDEQV CCCCCCCCCCCHHHE | 12.85 | 22817900 | |
| 165 | Ubiquitination | CLECNSSKLRGLKRK EEECCCHHHCCCCHH | 41.86 | - | |
| 212 | Ubiquitination | CNEEILGKDHTLKFV CCHHHCCCCCEEEEE | 42.78 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PCGF3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PCGF3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PCGF3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RING2_HUMAN | RNF2 | physical | 22325352 | |
| RING1_HUMAN | RING1 | physical | 22325352 | |
| RYBP_HUMAN | RYBP | physical | 22325352 | |
| YAF2_HUMAN | YAF2 | physical | 22325352 | |
| CBX4_HUMAN | CBX4 | physical | 22325352 | |
| MGAP_HUMAN | MGA | physical | 22325352 | |
| BCORL_HUMAN | BCORL1 | physical | 22325352 | |
| KDM2B_HUMAN | KDM2B | physical | 22325352 | |
| UBP7_HUMAN | USP7 | physical | 22325352 | |
| AUTS2_HUMAN | AUTS2 | physical | 22325352 | |
| FBRS_HUMAN | FBRS | physical | 22325352 | |
| FBSL_HUMAN | FBRSL1 | physical | 22325352 | |
| CSK21_HUMAN | CSNK2A1 | physical | 22325352 | |
| CSK22_HUMAN | CSNK2A2 | physical | 22325352 | |
| CSK2B_HUMAN | CSNK2B | physical | 22325352 | |
| BCOR_HUMAN | BCOR | physical | 23523425 | |
| BCORL_HUMAN | BCORL1 | physical | 23523425 | |
| RING2_HUMAN | RNF2 | physical | 22493164 | |
| BMI1_HUMAN | BMI1 | physical | 22493164 | |
| RING1_HUMAN | RING1 | physical | 22493164 | |
| BCOR_HUMAN | BCOR | physical | 25416956 | |
| RING2_HUMAN | RNF2 | physical | 26151332 | |
| PCGF3_HUMAN | PCGF3 | physical | 26151332 | |
| UB2D3_HUMAN | UBE2D3 | physical | 26151332 | |
| NISCH_HUMAN | NISCH | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...