SPOP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPOP_HUMAN
• UniProt AC: O43791
• Protein Name: Speckle-type POZ protein
• Gene Name: SPOP
• Organism: Homo sapiens (Human).
• Sequence Length: 374
• Subcellular Localization: Nucleus. Nucleus speckle.
• Protein Description: Component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, leading most often to their proteasomal degradation. In complex with CUL3, involved in ubiquitination and proteasomal degradation of BRMS1, DAXX, PDX1/IPF1, GLI2 and GLI3. In complex with CUL3, involved in ubiquitination of H2AFY and BMI1; this does not lead to their proteasomal degradation. Inhibits transcriptional activation of PDX1/IPF1 targets, such as insulin, by promoting PDX1/IPF1 degradation. The cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex containing homodimeric SPOP has higher ubiquitin ligase activity than the complex that contains the heterodimer formed by SPOP and SPOPL..
• Protein Sequence: MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSRVPSPPP ------CCCCCCCCC	41.82	26074081
6	Phosphorylation	--MSRVPSPPPPAEM --CCCCCCCCCCCHH	47.37	30108239
14	Phosphorylation	PPPPAEMSSGPVAES CCCCCHHCCCCCCCC	24.53	30108239
15	Phosphorylation	PPPAEMSSGPVAESW CCCCHHCCCCCCCCH	45.89	30108239
54	Phosphorylation	EMGEVIKSSTFSSGA HHHHHHHHCCCCCCC	24.40	-
64	Ubiquitination	FSSGANDKLKWCLRV CCCCCCCCCEEEEEE	52.34	32015554
110	Ubiquitination	KFSILNAKGEETKAM EEEEECCCCHHHHHH	66.82	21906983
115	Ubiquitination	NAKGEETKAMESQRA CCCCHHHHHHHHHHH	49.36	22817900
215	Ubiquitination	GQEFQAHKAILAARS CCHHHHHHHHHHHCC	39.89	-
237	Ubiquitination	EHEMEESKKNRVEIN HHHHHHHHCCCCCCC	58.30	32015554
238	Ubiquitination	HEMEESKKNRVEIND HHHHHHHCCCCCCCC	60.30	29967540
268	Ubiquitination	GKAPNLDKMADDLLA CCCCCHHHHHHHHHH	38.87	29901268
279	Ubiquitination	DLLAAADKYALERLK HHHHHHHHHHHHHHH	27.91	22053931
339	Acetylation	VLETSGWKSMVVSHP HHHHCCCCCEECCCH	32.00	7664267
340	Phosphorylation	LETSGWKSMVVSHPH HHHCCCCCEECCCHH	15.42	30257219
344	Phosphorylation	GWKSMVVSHPHLVAE CCCCEECCCHHHHHH	21.64	30257219
353	Phosphorylation	PHLVAEAYRSLASAQ HHHHHHHHHHHHHCC	7.70	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
6	S	Phosphorylation	Kinase	CDK4	P11802	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPOP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPOP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DPPA2_HUMAN	DPPA2	physical	16189514
RTN3_HUMAN	RTN3	physical	16189514
SIR2_HUMAN	SIRT2	physical	17353931
DOK2_HUMAN	DOK2	physical	17353931
IMA7_HUMAN	KPNA6	physical	17353931
GDIA_HUMAN	GDI1	physical	17353931
PI51B_HUMAN	PIP5K1B	physical	17353931
TRAF1_HUMAN	TRAF1	physical	11279055
TRAF6_HUMAN	TRAF6	physical	11279055
BMI1_HUMAN	BMI1	physical	15897469
NCOA3_HUMAN	NCOA3	physical	21577200
CUL3_HUMAN	CUL3	physical	21577200
ESR1_HUMAN	ESR1	physical	18414007
SPOP_HUMAN	SPOP	physical	15240113
PI42B_HUMAN	PIP4K2B	physical	18218622
NCOA3_HUMAN	NCOA3	physical	23559371
CUL3_HUMAN	CUL3	physical	16524876
DAXX_HUMAN	DAXX	physical	16524876
SRRM1_HUMAN	SRRM1	physical	21988832
ANDR_HUMAN	AR	physical	24508459
ATM_HUMAN	ATM	physical	24451148
SPOP_HUMAN	SPOP	physical	25278611
CUL3_HUMAN	CUL3	physical	25278611
ANDR_HUMAN	AR	physical	25274033
BRMS1_HUMAN	BRMS1	physical	22085717
DEK_HUMAN	DEK	physical	25278611
ERG_HUMAN	ERG	physical	26344095
ERF_HUMAN	ERF	physical	26344095
PRGR_HUMAN	PGR	physical	26693071
GLI3_HUMAN	GLI3	physical	26475525
ERG_HUMAN	ERG	physical	26344096
UB2D1_HUMAN	UBE2D1	physical	26344096
UB2D2_HUMAN	UBE2D2	physical	26344096
DDIT3_HUMAN	DDIT3	physical	24990631
ESR1_HUMAN	ESR1	physical	25766326
SPOP_HUMAN	SPOP	physical	27220849
GLI3_HUMAN	GLI3	physical	27220849
EGLN2_HUMAN	EGLN2	physical	28089830
GLI2_HUMAN	GLI2	physical	28032859
CUL3_HUMAN	CUL3	physical	28216678
BRD4_HUMAN	BRD4	physical	28805820
BRD3_HUMAN	BRD3	physical	28805820
BRD2_HUMAN	BRD2	physical	28805820

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.