UniProt ID | KLK10_HUMAN | |
---|---|---|
UniProt AC | O43240 | |
Protein Name | Kallikrein-10 | |
Gene Name | KLK10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 276 | |
Subcellular Localization | Secreted . | |
Protein Description | Has a tumor-suppressor role for NES1 in breast and prostate cancer.. | |
Protein Sequence | MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | N-linked_Glycosylation | EAALLPQNDTRLDPE HHHHCCCCCCCCCHH | 51.16 | UniProtKB CARBOHYD | |
125 | Phosphorylation | HPKYHQGSGPILPRR CCCCCCCCCCCCCCC | 34.52 | 21299198 | |
194 | Phosphorylation | GLTCSSITILSPKEC CCCEEEEEEECCCCC | 20.15 | - | |
197 | Phosphorylation | CSSITILSPKECEVF EEEEEEECCCCCEEE | 30.03 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KLK10_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KLK10_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KLK10_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LRIF1_HUMAN | LRIF1 | physical | 16169070 | |
EDC3_HUMAN | EDC3 | physical | 26186194 | |
O6C70_HUMAN | OR6C70 | physical | 26186194 | |
EDC3_HUMAN | EDC3 | physical | 28514442 | |
O6C70_HUMAN | OR6C70 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...