UniProt ID | COX17_HUMAN | |
---|---|---|
UniProt AC | Q14061 | |
Protein Name | Cytochrome c oxidase copper chaperone | |
Gene Name | COX17 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 63 | |
Subcellular Localization | Mitochondrion intermembrane space . Cytoplasm . | |
Protein Description | Copper metallochaperone essential for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. Binds two copper ions and delivers them to the metallochaperone SCO1 which transports the copper ions to the Cu(A) site on the cytochrome c oxidase subunit II (MT-CO2/COX2).. | |
Protein Sequence | MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MPGLVDSNPAPPES -CCCCCCCCCCCCHH | 36.91 | 28450419 | |
14 | Phosphorylation | SNPAPPESQEKKPLK CCCCCCHHHCCCCCC | 49.79 | 25159151 | |
17 | Acetylation | APPESQEKKPLKPCC CCCHHHCCCCCCCCC | 52.64 | 30585187 | |
17 | Ubiquitination | APPESQEKKPLKPCC CCCHHHCCCCCCCCC | 52.64 | 33845483 | |
18 | Acetylation | PPESQEKKPLKPCCA CCHHHCCCCCCCCCC | 55.63 | 25953088 | |
21 | Acetylation | SQEKKPLKPCCACPE HHCCCCCCCCCCCCC | 44.53 | 25953088 | |
30 | Acetylation | CCACPETKKARDACI CCCCCCCCCHHCEEE | 42.65 | 25953088 | |
31 | Acetylation | CACPETKKARDACII CCCCCCCCHHCEEEE | 56.95 | 7396163 | |
40 | Acetylation | RDACIIEKGEEHCGH HCEEEEECCHHHHHH | 62.30 | 25953088 | |
62 | Ubiquitination | CMRALGFKI------ HHHHHCCCC------ | 45.79 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX17_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX17_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX17_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KATL1_HUMAN | KATNAL1 | physical | 16189514 | |
RBM48_HUMAN | RBM48 | physical | 16169070 | |
CXCL7_HUMAN | PPBP | physical | 16169070 | |
CSN6_HUMAN | COPS6 | physical | 16169070 | |
ERG28_HUMAN | C14orf1 | physical | 16169070 | |
EF1A1_HUMAN | EEF1A1 | physical | 16169070 | |
P53_HUMAN | TP53 | physical | 16169070 | |
LRIF1_HUMAN | LRIF1 | physical | 16169070 | |
U119A_HUMAN | UNC119 | physical | 16169070 | |
ECHB_HUMAN | HADHB | physical | 21988832 | |
KATL1_HUMAN | KATNAL1 | physical | 25416956 | |
MIF_HUMAN | MIF | physical | 26344197 | |
SCYL2_HUMAN | SCYL2 | physical | 26344197 | |
TALDO_HUMAN | TALDO1 | physical | 26344197 | |
TBCA_HUMAN | TBCA | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...