| UniProt ID | COX17_HUMAN | |
|---|---|---|
| UniProt AC | Q14061 | |
| Protein Name | Cytochrome c oxidase copper chaperone | |
| Gene Name | COX17 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 63 | |
| Subcellular Localization | Mitochondrion intermembrane space . Cytoplasm . | |
| Protein Description | Copper metallochaperone essential for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. Binds two copper ions and delivers them to the metallochaperone SCO1 which transports the copper ions to the Cu(A) site on the cytochrome c oxidase subunit II (MT-CO2/COX2).. | |
| Protein Sequence | MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MPGLVDSNPAPPES -CCCCCCCCCCCCHH | 36.91 | 28450419 | |
| 14 | Phosphorylation | SNPAPPESQEKKPLK CCCCCCHHHCCCCCC | 49.79 | 25159151 | |
| 17 | Acetylation | APPESQEKKPLKPCC CCCHHHCCCCCCCCC | 52.64 | 30585187 | |
| 17 | Ubiquitination | APPESQEKKPLKPCC CCCHHHCCCCCCCCC | 52.64 | 33845483 | |
| 18 | Acetylation | PPESQEKKPLKPCCA CCHHHCCCCCCCCCC | 55.63 | 25953088 | |
| 21 | Acetylation | SQEKKPLKPCCACPE HHCCCCCCCCCCCCC | 44.53 | 25953088 | |
| 30 | Acetylation | CCACPETKKARDACI CCCCCCCCCHHCEEE | 42.65 | 25953088 | |
| 31 | Acetylation | CACPETKKARDACII CCCCCCCCHHCEEEE | 56.95 | 7396163 | |
| 40 | Acetylation | RDACIIEKGEEHCGH HCEEEEECCHHHHHH | 62.30 | 25953088 | |
| 62 | Ubiquitination | CMRALGFKI------ HHHHHCCCC------ | 45.79 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX17_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX17_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX17_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KATL1_HUMAN | KATNAL1 | physical | 16189514 | |
| RBM48_HUMAN | RBM48 | physical | 16169070 | |
| CXCL7_HUMAN | PPBP | physical | 16169070 | |
| CSN6_HUMAN | COPS6 | physical | 16169070 | |
| ERG28_HUMAN | C14orf1 | physical | 16169070 | |
| EF1A1_HUMAN | EEF1A1 | physical | 16169070 | |
| P53_HUMAN | TP53 | physical | 16169070 | |
| LRIF1_HUMAN | LRIF1 | physical | 16169070 | |
| U119A_HUMAN | UNC119 | physical | 16169070 | |
| ECHB_HUMAN | HADHB | physical | 21988832 | |
| KATL1_HUMAN | KATNAL1 | physical | 25416956 | |
| MIF_HUMAN | MIF | physical | 26344197 | |
| SCYL2_HUMAN | SCYL2 | physical | 26344197 | |
| TALDO_HUMAN | TALDO1 | physical | 26344197 | |
| TBCA_HUMAN | TBCA | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
