UniProt ID | TBCA_HUMAN | |
---|---|---|
UniProt AC | O75347 | |
Protein Name | Tubulin-specific chaperone A | |
Gene Name | TBCA | |
Organism | Homo sapiens (Human). | |
Sequence Length | 108 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Tubulin-folding protein; involved in the early step of the tubulin folding pathway.. | |
Protein Sequence | MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Ubiquitination | DPRVRQIKIKTGVVK CCCHHHHHHCHHHHH | 29.79 | - | |
10 | Ubiquitination | DPRVRQIKIKTGVVK CCCHHHHHHCHHHHH | 29.79 | - | |
12 | Ubiquitination | RVRQIKIKTGVVKRL CHHHHHHCHHHHHHH | 33.94 | - | |
17 | Ubiquitination | KIKTGVVKRLVKEKV HHCHHHHHHHHHHHH | 37.29 | - | |
23 | 2-Hydroxyisobutyrylation | VKRLVKEKVMYEKEA HHHHHHHHHHHHHHH | 26.95 | - | |
23 | Acetylation | VKRLVKEKVMYEKEA HHHHHHHHHHHHHHH | 26.95 | 23749302 | |
23 | Acetylation | VKRLVKEKVMYEKEA HHHHHHHHHHHHHHH | 26.95 | - | |
28 | 2-Hydroxyisobutyrylation | KEKVMYEKEAKQQEE HHHHHHHHHHHHHHH | 45.55 | - | |
28 | Ubiquitination | KEKVMYEKEAKQQEE HHHHHHHHHHHHHHH | 45.55 | 19608861 | |
28 | Ubiquitination | KEKVMYEKEAKQQEE HHHHHHHHHHHHHHH | 45.55 | - | |
28 | Acetylation | KEKVMYEKEAKQQEE HHHHHHHHHHHHHHH | 45.55 | 23749302 | |
28 | Acetylation | KEKVMYEKEAKQQEE HHHHHHHHHHHHHHH | 45.55 | - | |
31 | Ubiquitination | VMYEKEAKQQEEKIE HHHHHHHHHHHHHHH | 54.31 | - | |
31 | Ubiquitination | VMYEKEAKQQEEKIE HHHHHHHHHHHHHHH | 54.31 | - | |
36 | Acetylation | EAKQQEEKIEKMRAE HHHHHHHHHHHHHHH | 56.25 | 23749302 | |
36 | Acetylation | EAKQQEEKIEKMRAE HHHHHHHHHHHHHHH | 56.25 | - | |
39 | Ubiquitination | QQEEKIEKMRAEDGE HHHHHHHHHHHHCCC | 36.84 | - | |
40 | Sulfoxidation | QEEKIEKMRAEDGEN HHHHHHHHHHHCCCC | 2.97 | 30846556 | |
48 | Phosphorylation | RAEDGENYDIKKQAE HHHCCCCCCHHHHHH | 18.10 | 21945579 | |
51 | Ubiquitination | DGENYDIKKQAEILQ CCCCCCHHHHHHHHH | 35.62 | 21890473 | |
51 | Acetylation | DGENYDIKKQAEILQ CCCCCCHHHHHHHHH | 35.62 | - | |
51 | Acetylation | DGENYDIKKQAEILQ CCCCCCHHHHHHHHH | 35.62 | 26822725 | |
52 | Ubiquitination | GENYDIKKQAEILQE CCCCCHHHHHHHHHH | 55.89 | 21890473 | |
52 | 2-Hydroxyisobutyrylation | GENYDIKKQAEILQE CCCCCHHHHHHHHHH | 55.89 | - | |
60 | Phosphorylation | QAEILQESRMMIPDC HHHHHHHHHCCCHHH | 16.71 | 20068231 | |
61 | Methylation | AEILQESRMMIPDCQ HHHHHHHHCCCHHHH | 20.24 | 115918277 | |
75 | Phosphorylation | QRRLEAAYLDLQRIL HHHHHHHHHHHHHHH | 14.06 | 28152594 | |
86 | Ubiquitination | QRILENEKDLEEAEE HHHHHCCCCHHHHHH | 78.26 | 21906983 | |
86 | Acetylation | QRILENEKDLEEAEE HHHHHCCCCHHHHHH | 78.26 | 23749302 | |
94 | Phosphorylation | DLEEAEEYKEARLVL CHHHHHHHHHHHHHH | 12.97 | 28796482 | |
94 | Nitration | DLEEAEEYKEARLVL CHHHHHHHHHHHHHH | 12.97 | - | |
95 | Ubiquitination | LEEAEEYKEARLVLD HHHHHHHHHHHHHHH | 48.45 | 2190698 | |
95 | Acetylation | LEEAEEYKEARLVLD HHHHHHHHHHHHHHH | 48.45 | 25953088 | |
103 | Phosphorylation | EARLVLDSVKLEA-- HHHHHHHHHHCCC-- | 19.59 | 21712546 | |
105 | Acetylation | RLVLDSVKLEA---- HHHHHHHHCCC---- | 44.56 | 25953088 | |
105 | Ubiquitination | RLVLDSVKLEA---- HHHHHHHHCCC---- | 44.56 | 21906983 | |
105 | 2-Hydroxyisobutyrylation | RLVLDSVKLEA---- HHHHHHHHCCC---- | 44.56 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBCA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBCA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBCA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UPAR_HUMAN | PLAUR | physical | 22939629 | |
GDPP1_HUMAN | GDPGP1 | physical | 26344197 | |
SC31A_HUMAN | SEC31A | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-28, AND MASS SPECTROMETRY. |