| UniProt ID | TBCA_HUMAN | |
|---|---|---|
| UniProt AC | O75347 | |
| Protein Name | Tubulin-specific chaperone A | |
| Gene Name | TBCA | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 108 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Tubulin-folding protein; involved in the early step of the tubulin folding pathway.. | |
| Protein Sequence | MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Ubiquitination | DPRVRQIKIKTGVVK CCCHHHHHHCHHHHH | 29.79 | - | |
| 10 | Ubiquitination | DPRVRQIKIKTGVVK CCCHHHHHHCHHHHH | 29.79 | - | |
| 12 | Ubiquitination | RVRQIKIKTGVVKRL CHHHHHHCHHHHHHH | 33.94 | - | |
| 17 | Ubiquitination | KIKTGVVKRLVKEKV HHCHHHHHHHHHHHH | 37.29 | - | |
| 23 | 2-Hydroxyisobutyrylation | VKRLVKEKVMYEKEA HHHHHHHHHHHHHHH | 26.95 | - | |
| 23 | Acetylation | VKRLVKEKVMYEKEA HHHHHHHHHHHHHHH | 26.95 | 23749302 | |
| 23 | Acetylation | VKRLVKEKVMYEKEA HHHHHHHHHHHHHHH | 26.95 | - | |
| 28 | 2-Hydroxyisobutyrylation | KEKVMYEKEAKQQEE HHHHHHHHHHHHHHH | 45.55 | - | |
| 28 | Ubiquitination | KEKVMYEKEAKQQEE HHHHHHHHHHHHHHH | 45.55 | 19608861 | |
| 28 | Ubiquitination | KEKVMYEKEAKQQEE HHHHHHHHHHHHHHH | 45.55 | - | |
| 28 | Acetylation | KEKVMYEKEAKQQEE HHHHHHHHHHHHHHH | 45.55 | 23749302 | |
| 28 | Acetylation | KEKVMYEKEAKQQEE HHHHHHHHHHHHHHH | 45.55 | - | |
| 31 | Ubiquitination | VMYEKEAKQQEEKIE HHHHHHHHHHHHHHH | 54.31 | - | |
| 31 | Ubiquitination | VMYEKEAKQQEEKIE HHHHHHHHHHHHHHH | 54.31 | - | |
| 36 | Acetylation | EAKQQEEKIEKMRAE HHHHHHHHHHHHHHH | 56.25 | 23749302 | |
| 36 | Acetylation | EAKQQEEKIEKMRAE HHHHHHHHHHHHHHH | 56.25 | - | |
| 39 | Ubiquitination | QQEEKIEKMRAEDGE HHHHHHHHHHHHCCC | 36.84 | - | |
| 40 | Sulfoxidation | QEEKIEKMRAEDGEN HHHHHHHHHHHCCCC | 2.97 | 30846556 | |
| 48 | Phosphorylation | RAEDGENYDIKKQAE HHHCCCCCCHHHHHH | 18.10 | 21945579 | |
| 51 | Ubiquitination | DGENYDIKKQAEILQ CCCCCCHHHHHHHHH | 35.62 | 21890473 | |
| 51 | Acetylation | DGENYDIKKQAEILQ CCCCCCHHHHHHHHH | 35.62 | - | |
| 51 | Acetylation | DGENYDIKKQAEILQ CCCCCCHHHHHHHHH | 35.62 | 26822725 | |
| 52 | Ubiquitination | GENYDIKKQAEILQE CCCCCHHHHHHHHHH | 55.89 | 21890473 | |
| 52 | 2-Hydroxyisobutyrylation | GENYDIKKQAEILQE CCCCCHHHHHHHHHH | 55.89 | - | |
| 60 | Phosphorylation | QAEILQESRMMIPDC HHHHHHHHHCCCHHH | 16.71 | 20068231 | |
| 61 | Methylation | AEILQESRMMIPDCQ HHHHHHHHCCCHHHH | 20.24 | 115918277 | |
| 75 | Phosphorylation | QRRLEAAYLDLQRIL HHHHHHHHHHHHHHH | 14.06 | 28152594 | |
| 86 | Ubiquitination | QRILENEKDLEEAEE HHHHHCCCCHHHHHH | 78.26 | 21906983 | |
| 86 | Acetylation | QRILENEKDLEEAEE HHHHHCCCCHHHHHH | 78.26 | 23749302 | |
| 94 | Phosphorylation | DLEEAEEYKEARLVL CHHHHHHHHHHHHHH | 12.97 | 28796482 | |
| 94 | Nitration | DLEEAEEYKEARLVL CHHHHHHHHHHHHHH | 12.97 | - | |
| 95 | Ubiquitination | LEEAEEYKEARLVLD HHHHHHHHHHHHHHH | 48.45 | 2190698 | |
| 95 | Acetylation | LEEAEEYKEARLVLD HHHHHHHHHHHHHHH | 48.45 | 25953088 | |
| 103 | Phosphorylation | EARLVLDSVKLEA-- HHHHHHHHHHCCC-- | 19.59 | 21712546 | |
| 105 | Acetylation | RLVLDSVKLEA---- HHHHHHHHCCC---- | 44.56 | 25953088 | |
| 105 | Ubiquitination | RLVLDSVKLEA---- HHHHHHHHCCC---- | 44.56 | 21906983 | |
| 105 | 2-Hydroxyisobutyrylation | RLVLDSVKLEA---- HHHHHHHHCCC---- | 44.56 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBCA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBCA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBCA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UPAR_HUMAN | PLAUR | physical | 22939629 | |
| GDPP1_HUMAN | GDPGP1 | physical | 26344197 | |
| SC31A_HUMAN | SEC31A | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-28, AND MASS SPECTROMETRY. | |