| UniProt ID | RHBL4_HUMAN | |
|---|---|---|
| UniProt AC | Q8TEB9 | |
| Protein Name | Rhomboid-related protein 4 | |
| Gene Name | RHBDD1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 315 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein. Mitochondrion . |
|
| Protein Description | Intramembrane-cleaving serine protease that cleaves single transmembrane or multi-pass membrane proteins in the hydrophobic plane of the membrane, luminal loops and juxtamembrane regions. Involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded membrane proteins. Required for the degradation process of some specific misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Functions in BIK, MPZ, PKD1, PTCRA, RHO, STEAP3 and TRAC processing. Involved in the regulation of exosomal secretion; inhibits the TSAP6-mediated secretion pathway. Involved in the regulation of apoptosis; modulates BIK-mediated apoptotic activity. Also plays a role in the regulation of spermatogenesis; inhibits apoptotic activity in spermatogonia.. | |
| Protein Sequence | MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCYQQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYLLLQFAVAEFMDEPDFKRSCAVGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVELVAIHLFSPGTSFAGHLAGILVGLMYTQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 82 | Phosphorylation | HADDWHLYFNMASML CCCCHHHHHHHHHHH | - | ||
| 87 | Phosphorylation | HLYFNMASMLWKGIN HHHHHHHHHHHCCCC | - | ||
| 236 | Phosphorylation | GRQYYFNSSGSSGYQ CCEEEECCCCCCCCC | 28796482 | ||
| 237 | Phosphorylation | RQYYFNSSGSSGYQD CEEEECCCCCCCCCC | 28796482 | ||
| 239 | Phosphorylation | YYFNSSGSSGYQDYY EEECCCCCCCCCCCC | 28796482 | ||
| 240 | Phosphorylation | YFNSSGSSGYQDYYP EECCCCCCCCCCCCC | 28796482 | ||
| 242 | Phosphorylation | NSSGSSGYQDYYPHG CCCCCCCCCCCCCCC | 28796482 | ||
| 245 | Phosphorylation | GSSGYQDYYPHGRPD CCCCCCCCCCCCCCC | 28796482 | ||
| 246 | Phosphorylation | SSGYQDYYPHGRPDH CCCCCCCCCCCCCCC | 28796482 | ||
| 254 | Phosphorylation | PHGRPDHYEEAPRNY CCCCCCCCCCCCCCC | 28796482 | ||
| 261 | Phosphorylation | YEEAPRNYDTYTAGL CCCCCCCCCCCCCCC | 28796482 | ||
| 263 | Phosphorylation | EAPRNYDTYTAGLSE CCCCCCCCCCCCCCH | 28796482 | ||
| 264 | Phosphorylation | APRNYDTYTAGLSEE CCCCCCCCCCCCCHH | 28796482 | ||
| 269 | Phosphorylation | DTYTAGLSEEEQLER CCCCCCCCHHHHHHH | 27134283 | ||
| 281 | Phosphorylation | LERALQASLWDRGNT HHHHHHHHHHHCCCC | 28857561 | ||
| 285 | Methylation | LQASLWDRGNTRNSP HHHHHHHCCCCCCCC | 115491223 | ||
| 288 | Phosphorylation | SLWDRGNTRNSPPPY HHHHCCCCCCCCCCC | 30108239 | ||
| 291 | Phosphorylation | DRGNTRNSPPPYGFH HCCCCCCCCCCCCCC | 26055452 | ||
| 295 | Phosphorylation | TRNSPPPYGFHLSPE CCCCCCCCCCCCCHH | 30108239 | ||
| 300 | Phosphorylation | PPYGFHLSPEEMRRQ CCCCCCCCHHHHHHH | 28985074 | ||
| 314 | Phosphorylation | QRLHRFDSQ------ HHHHHHCCC------ | 28355574 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHBL4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHBL4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHBL4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TERA_HUMAN | VCP | physical | 27407164 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
