UniProt ID | TEX37_HUMAN | |
---|---|---|
UniProt AC | Q96LM6 | |
Protein Name | Testis-expressed sequence 37 protein | |
Gene Name | TEX37 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 180 | |
Subcellular Localization | Nucleus . Cytoplasm . Present in the germ cell lineage at all stages (PubMed:26168773). | |
Protein Description | ||
Protein Sequence | MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Acetylation | ---MAGVKYPGQDPV ---CCCCCCCCCCCC | 25038526 | ||
6 | Phosphorylation | --MAGVKYPGQDPVD --CCCCCCCCCCCCC | - | ||
25 | Phosphorylation | QSSHMVDYQPYRKHK CCCCCCCCCCCCCCC | - | ||
28 | Phosphorylation | HMVDYQPYRKHKYSR CCCCCCCCCCCCCCC | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TEX37_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TEX37_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TEX37_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...