UniProt ID | PKHB2_HUMAN | |
---|---|---|
UniProt AC | Q96CS7 | |
Protein Name | Pleckstrin homology domain-containing family B member 2 | |
Gene Name | PLEKHB2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 222 | |
Subcellular Localization |
Recycling endosome membrane Peripheral membrane protein . Specifically detected in tubulovesicular structures, and colocalizes with TFNR. |
|
Protein Description | Involved in retrograde transport of recycling endosomes.. | |
Protein Sequence | MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Ubiquitination | LRQSTILKRWKKNWF EHHHHHHHHHHHHCC | 52.97 | - | |
46 | Ubiquitination | TRQNIEDKVHMPMDC CCCCHHHCCCCCCEE | 22.65 | - | |
58 | Phosphorylation | MDCINIRTGQECRDT CEEEEECCCCCCCCC | 39.15 | - | |
71 | Ubiquitination | DTQPPDGKSKDCMLQ CCCCCCCCCCCEEEE | 62.81 | - | |
73 | Ubiquitination | QPPDGKSKDCMLQIV CCCCCCCCCEEEEEE | 59.43 | - | |
103 (in isoform 6) | Phosphorylation | - | 21.56 | 27307780 | |
107 (in isoform 6) | Phosphorylation | - | 28.22 | 27307780 | |
109 (in isoform 6) | Phosphorylation | - | 40.65 | 27307780 | |
111 (in isoform 6) | Phosphorylation | - | 20.82 | 27307780 | |
113 (in isoform 6) | Phosphorylation | - | 11.87 | 27307780 | |
116 (in isoform 6) | Phosphorylation | - | 13.98 | 27307780 | |
120 (in isoform 6) | Phosphorylation | - | 24.88 | 27307780 | |
123 (in isoform 6) | Phosphorylation | - | 29.63 | 27307780 | |
124 (in isoform 6) | Phosphorylation | - | 20.62 | 27307780 | |
127 (in isoform 6) | Phosphorylation | - | 34.66 | 27307780 | |
128 (in isoform 6) | Phosphorylation | - | 29.80 | 27307780 | |
132 (in isoform 6) | Phosphorylation | - | 15.13 | 27307780 | |
133 (in isoform 6) | Phosphorylation | - | 20.97 | 27307780 | |
144 | Phosphorylation | APAPEQAYGYGPYGG CCCCHHHCCCCCCCC | 15.58 | - | |
255 (in isoform 2) | Phosphorylation | - | 28450419 | ||
257 (in isoform 2) | Phosphorylation | - | 28450419 | ||
258 (in isoform 2) | Phosphorylation | - | 28450419 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PKHB2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PKHB2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PKHB2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KRT85_HUMAN | KRT85 | physical | 17353931 | |
K1H1_HUMAN | KRT31 | physical | 17353931 | |
KRT82_HUMAN | KRT82 | physical | 17353931 | |
KRT34_HUMAN | KRT34 | physical | 17353931 | |
CA094_HUMAN | C1orf94 | physical | 25416956 | |
CYTM_HUMAN | CST6 | physical | 26186194 | |
ITCH_HUMAN | ITCH | physical | 26186194 | |
FBX50_HUMAN | NCCRP1 | physical | 26186194 | |
LOXE3_HUMAN | ALOXE3 | physical | 26186194 | |
CYTM_HUMAN | CST6 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...