| UniProt ID | PKHB2_HUMAN | |
|---|---|---|
| UniProt AC | Q96CS7 | |
| Protein Name | Pleckstrin homology domain-containing family B member 2 | |
| Gene Name | PLEKHB2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 222 | |
| Subcellular Localization |
Recycling endosome membrane Peripheral membrane protein . Specifically detected in tubulovesicular structures, and colocalizes with TFNR. |
|
| Protein Description | Involved in retrograde transport of recycling endosomes.. | |
| Protein Sequence | MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Ubiquitination | LRQSTILKRWKKNWF EHHHHHHHHHHHHCC | 52.97 | - | |
| 46 | Ubiquitination | TRQNIEDKVHMPMDC CCCCHHHCCCCCCEE | 22.65 | - | |
| 58 | Phosphorylation | MDCINIRTGQECRDT CEEEEECCCCCCCCC | 39.15 | - | |
| 71 | Ubiquitination | DTQPPDGKSKDCMLQ CCCCCCCCCCCEEEE | 62.81 | - | |
| 73 | Ubiquitination | QPPDGKSKDCMLQIV CCCCCCCCCEEEEEE | 59.43 | - | |
| 103 (in isoform 6) | Phosphorylation | - | 21.56 | 27307780 | |
| 107 (in isoform 6) | Phosphorylation | - | 28.22 | 27307780 | |
| 109 (in isoform 6) | Phosphorylation | - | 40.65 | 27307780 | |
| 111 (in isoform 6) | Phosphorylation | - | 20.82 | 27307780 | |
| 113 (in isoform 6) | Phosphorylation | - | 11.87 | 27307780 | |
| 116 (in isoform 6) | Phosphorylation | - | 13.98 | 27307780 | |
| 120 (in isoform 6) | Phosphorylation | - | 24.88 | 27307780 | |
| 123 (in isoform 6) | Phosphorylation | - | 29.63 | 27307780 | |
| 124 (in isoform 6) | Phosphorylation | - | 20.62 | 27307780 | |
| 127 (in isoform 6) | Phosphorylation | - | 34.66 | 27307780 | |
| 128 (in isoform 6) | Phosphorylation | - | 29.80 | 27307780 | |
| 132 (in isoform 6) | Phosphorylation | - | 15.13 | 27307780 | |
| 133 (in isoform 6) | Phosphorylation | - | 20.97 | 27307780 | |
| 144 | Phosphorylation | APAPEQAYGYGPYGG CCCCHHHCCCCCCCC | 15.58 | - | |
| 255 (in isoform 2) | Phosphorylation | - | 28450419 | ||
| 257 (in isoform 2) | Phosphorylation | - | 28450419 | ||
| 258 (in isoform 2) | Phosphorylation | - | 28450419 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PKHB2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PKHB2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PKHB2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KRT85_HUMAN | KRT85 | physical | 17353931 | |
| K1H1_HUMAN | KRT31 | physical | 17353931 | |
| KRT82_HUMAN | KRT82 | physical | 17353931 | |
| KRT34_HUMAN | KRT34 | physical | 17353931 | |
| CA094_HUMAN | C1orf94 | physical | 25416956 | |
| CYTM_HUMAN | CST6 | physical | 26186194 | |
| ITCH_HUMAN | ITCH | physical | 26186194 | |
| FBX50_HUMAN | NCCRP1 | physical | 26186194 | |
| LOXE3_HUMAN | ALOXE3 | physical | 26186194 | |
| CYTM_HUMAN | CST6 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
