UniProt ID | CI116_HUMAN | |
---|---|---|
UniProt AC | Q5BN46 | |
Protein Name | UPF0691 protein C9orf116 | |
Gene Name | C9orf116 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 136 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Ubiquitination | CAEPVAPKATAPPER HCCCCCCCCCCCCCC | 48.94 | 29967540 | |
27 | Phosphorylation | PPERTSDYYRVSADL CCCCCCCCEEEECCC | 7.92 | - | |
47 | Phosphorylation | NPGWFRGYRTQKAVS CCCCCCCCCHHCEEE | 13.26 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CI116_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CI116_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CI116_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HSP7C_HUMAN | HSPA8 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...