CI106_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CI106_HUMAN
• UniProt AC: Q8NAJ2
• Protein Name: Putative uncharacterized protein C9orf106
• Gene Name: C9orf106
• Organism: Homo sapiens (Human).
• Sequence Length: 232
• Protein Sequence: MAYVALSDKPHLSGEVGEEACSSWNPPLFSPRPLPRLWPLPGTPFLPIRALPFSASSSGKSSLVPSPSSSAHSGFRTPCLGPDCLLCTQGCELHEGRNHMAVHSCVARAWPGDPQEVRHLNPLLCDPGSQVEPSWPWHPGLEQAAASWVGNHVSPAHRQALRGHSLGSALRALMPGRHCPLCVPCKRGCDLRGGRGKHGPRPCCPLLRKFPVLPVHPWPFPCAVWDSGWSCR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	Phosphorylation	ASSSGKSSLVPSPSS CCCCCCCCCCCCCCC	36.55	22210691
70	Phosphorylation	LVPSPSSSAHSGFRT CCCCCCCCCCCCCCC	34.05	29507054

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CI106_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CI106_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CI106_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PSMG3_HUMAN	PSMG3	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.