UniProt ID | F218A_HUMAN | |
---|---|---|
UniProt AC | Q96MZ4 | |
Protein Name | Protein FAM218A | |
Gene Name | FAM218A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 157 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEGCAVRRGSCPLLPGPSAWRASPAGWAGRAKLRSWCRASGLPNRPYTLTGGRHGSVSLLRHPGTTTFVQQRSLHQSWEKRIVFSACPVSRSWCPERNFSGSIPAVTPPKLPGHSKSEGPPGKVRKRTTIRSQPLFVTRTRGFGSAVGWLPLGSPVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | GCAVRRGSCPLLPGP CCCCCCCCCCCCCCC | 15.68 | 24719451 | |
32 | Trimethylation | AGWAGRAKLRSWCRA CCHHHHHHHHHHHHH | 42.97 | - | |
32 | Methylation | AGWAGRAKLRSWCRA CCHHHHHHHHHHHHH | 42.97 | 23644510 | |
40 | Phosphorylation | LRSWCRASGLPNRPY HHHHHHHCCCCCCCE | 22.85 | - | |
92 | Phosphorylation | SACPVSRSWCPERNF EECCCCHHHCCCCCC | 26.06 | 27251275 | |
100 | Phosphorylation | WCPERNFSGSIPAVT HCCCCCCCCCCCCCC | 34.87 | 29449344 | |
102 | Phosphorylation | PERNFSGSIPAVTPP CCCCCCCCCCCCCCC | 24.97 | 29449344 | |
107 | Phosphorylation | SGSIPAVTPPKLPGH CCCCCCCCCCCCCCC | 35.66 | 29449344 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of F218A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F218A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F218A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of F218A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...