| UniProt ID | OSR2_HUMAN | |
|---|---|---|
| UniProt AC | Q8N2R0 | |
| Protein Name | Protein odd-skipped-related 2 | |
| Gene Name | OSR2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 312 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | ||
| Protein Sequence | MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPNVHEITRSTITEMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFANLAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCEQCGKVFRRNCDLRRHSLTHTPRQDF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 60 (in isoform 3) | Phosphorylation | - | 39.02 | 22210691 | |
| 137 | Phosphorylation | PPKMGDLSKLSPGLG CCCCCCHHHCCCCCC | 35.97 | 26434776 | |
| 140 | Phosphorylation | MGDLSKLSPGLGSPI CCCHHHCCCCCCCCC | 22.21 | 25849741 | |
| 145 | Phosphorylation | KLSPGLGSPISGLSK HCCCCCCCCCCCHHH | 24.89 | 25849741 | |
| 148 | Phosphorylation | PGLGSPISGLSKLTP CCCCCCCCCHHHCCC | 36.75 | 26434776 | |
| 151 | Phosphorylation | GSPISGLSKLTPDRK CCCCCCHHHCCCCCC | 29.19 | 26434776 | |
| 166 | Phosphorylation | PSRGRLPSKTKKEFI CCCCCCCCCCCHHHH | 58.51 | 24719451 | |
| 200 | Phosphorylation | THTDERPYTCDICHK CCCCCCCCCCHHHHH | 26.65 | 12119563 | |
| 305 | Phosphorylation | DLRRHSLTHTPRQDF CCCCCCCCCCCCCCC | 27.07 | 28348404 | |
| 307 | Phosphorylation | RRHSLTHTPRQDF-- CCCCCCCCCCCCC-- | 18.22 | 28348404 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OSR2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OSR2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OSR2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of OSR2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
