RAM_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAM_HUMAN
• UniProt AC: Q9BTL3
• Protein Name: RNMT-activating mini protein
• Gene Name: FAM103A1
• Organism: Homo sapiens (Human).
• Sequence Length: 118
• Subcellular Localization: Nucleus .
• Protein Description: Regulatory subunit of the mRNA-capping methyltransferase RNMT:RAM/FAM103A1 complex that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. [PubMed: 22099306]
• Protein Sequence: MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RAM_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAM_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAM_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAM_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RHXF2_HUMAN	RHOXF2	physical	16189514
LZTS2_HUMAN	LZTS2	physical	25416956
RBY1F_HUMAN	RBMY1F	physical	25416956
TRI42_HUMAN	TRIM42	physical	25416956
INCA1_HUMAN	INCA1	physical	25416956
EXOC7_HUMAN	EXOC7	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.