FXL12_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FXL12_HUMAN
• UniProt AC: Q9NXK8
• Protein Name: F-box/LRR-repeat protein 12
• Gene Name: FBXL12
• Organism: Homo sapiens (Human).
• Sequence Length: 326
• Protein Description: Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Mediates the polyubiquitination and proteasomal degradation of CAMK1 leading to disruption of cyclin D1/CDK4 complex assembly which results in G1 cell cycle arrest in lung epithelia..
• Protein Sequence: MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKESMDWWM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
100	Ubiquitination	LLRALGQKCPNLKRL HHHHHHCCCCCHHHH	50.27	-
124	Phosphorylation	VPITSLPSTLRTLEL CCCCCCCCHHHHEEE	45.42	-
187	Phosphorylation	SLVLGGTYRVTETGL HHHHCCEEEECCCCH	13.32	27273156
224	Phosphorylation	DSTLLAISRHLRDVR CHHHHHHHHHHHCHH	14.19	24719451
248	Ubiquitination	SAPGLAVLEGMPALE CCCCCHHHCCCHHHH	3.81	22817900
252 (in isoform 2)	Ubiquitination	-	44.54	21890473
252	Ubiquitination	LAVLEGMPALESLCL CHHHCCCHHHHHHHH	44.54	21890473
259	Ubiquitination	PALESLCLQGPLVTP HHHHHHHHCCCCCCC	8.82	22817900
263	Ubiquitination	SLCLQGPLVTPEMPS HHHHCCCCCCCCCCC	9.54	21890473
266	Ubiquitination	LQGPLVTPEMPSPTE HCCCCCCCCCCCHHH	28.54	22505724
268	Ubiquitination	GPLVTPEMPSPTEIL CCCCCCCCCCHHHHH	4.13	22817900
272	Ubiquitination	TPEMPSPTEILSSCL CCCCCCHHHHHHHHC	39.74	21890473
277	Ubiquitination	SPTEILSSCLTMPKL CHHHHHHHHCCCCCE	15.08	22505724
286	Ubiquitination	LTMPKLRVLELQGLG CCCCCEEEEEECCCC	7.64	22505724
301	Ubiquitination	WEGQEAEKILCKGLP CCCHHHHHHHHCCCC	48.29	22817900
305 (in isoform 1)	Ubiquitination	-	61.10	21890473
305	Ubiquitination	EAEKILCKGLPHCMV HHHHHHHCCCCCEEE	61.10	22817900
318	Ubiquitination	MVIVRACPKESMDWW EEEEECCCHHHCCCC	42.33	22817900
319	Ubiquitination	VIVRACPKESMDWWM EEEECCCHHHCCCCC	63.41	22505724
322	Ubiquitination	RACPKESMDWWM--- ECCCHHHCCCCC---	5.39	21890473
336	Ubiquitination	----------------- -----------------		22505724

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	FBXO3	Q9UK99	PMID:24658274

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FXL12_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FXL12_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FXYD3_HUMAN	FXYD3	physical	16169070
JUN_HUMAN	JUN	physical	17704768
CDN1C_HUMAN	CDKN1C	physical	18660753
CUL1_HUMAN	CUL1	physical	18660753
SKP1_HUMAN	SKP1	physical	18660753
RBX1_HUMAN	RBX1	physical	18660753
ECSIT_HUMAN	ECSIT	physical	21163940
RNF32_HUMAN	RNF32	physical	21163940
CUL1_HUMAN	CUL1	physical	23324393
SKP1_HUMAN	SKP1	physical	23324393
PRAME_HUMAN	PRAME	physical	24035498
STYX_HUMAN	STYX	physical	24035498
DOCK8_HUMAN	DOCK8	physical	25416956
LNX1_HUMAN	LNX1	physical	25416956
AL3A1_HUMAN	ALDH3A1	physical	26124079
AL3A2_HUMAN	ALDH3A2	physical	26124079
RINI_HUMAN	RNH1	physical	26124079
ANXA2_HUMAN	ANXA2	physical	26124079
GSTP1_HUMAN	GSTP1	physical	26124079
HGH1_HUMAN	HGH1	physical	26124079
CAN1_HUMAN	CAPN1	physical	26124079
CAN2_HUMAN	CAPN2	physical	26124079
SLAP1_HUMAN	SLA	physical	26124079
RCN1_HUMAN	RCN1	physical	26124079
TTC27_HUMAN	TTC27	physical	26124079
ASTN2_HUMAN	ASTN2	physical	26124079
CUL1_HUMAN	CUL1	physical	26124079
SKP1_HUMAN	SKP1	physical	26124079
UB2D3_HUMAN	UBE2D3	physical	26124079
AL3B1_HUMAN	ALDH3B1	physical	26124079
FXL12_HUMAN	FBXL12	physical	29124172

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.