UniProt ID | SLAP1_HUMAN | |
---|---|---|
UniProt AC | Q13239 | |
Protein Name | Src-like-adapter | |
Gene Name | SLA | |
Organism | Homo sapiens (Human). | |
Sequence Length | 276 | |
Subcellular Localization | Cytoplasm. Endosome. Colocalizes with endosomes.. | |
Protein Description | Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. Involved in the negative regulation of positive selection and mitosis of T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins.. | |
Protein Sequence | MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGNSMKSTP ------CCCCCCCCC | 34.61 | - | |
8 (in isoform 4) | Phosphorylation | - | 20.25 | - | |
8 (in isoform 3) | Phosphorylation | - | 20.25 | - | |
9 | Ubiquitination | GNSMKSTPAPAERPL CCCCCCCCCCCCCCC | 43.25 | - | |
15 | Ubiquitination | TPAPAERPLPNPEGL CCCCCCCCCCCCCCC | 43.61 | - | |
18 | Phosphorylation | PAERPLPNPEGLDSD CCCCCCCCCCCCCCC | 55.74 | 24719451 | |
18 (in isoform 5) | Phosphorylation | - | 55.74 | 24719451 | |
31 (in isoform 5) | Phosphorylation | - | 28.62 | - | |
31 | Phosphorylation | SDFLAVLSDYPSPDI CCHHHHHCCCCCCCC | 28.62 | - | |
60 | Ubiquitination | SDEGGWWKAISLSTG ECCCCEEEEEECCCC | 29.36 | 22505724 | |
77 | Ubiquitination | SYIPGICVARVYHGW CCCCCEEEEEEECCH | 3.44 | - | |
77 | Ubiquitination | SYIPGICVARVYHGW CCCCCEEEEEEECCH | 3.44 | 22505724 | |
93 | Ubiquitination | FEGLGRDKAEELLQL HCCCCCHHHHHHHCC | 57.23 | 22505724 | |
100 | Ubiquitination | KAEELLQLPDTKVGS HHHHHHCCCCCCCEE | 4.12 | 22505724 | |
104 | Ubiquitination | LLQLPDTKVGSFMIR HHCCCCCCCEEEEEE | 52.56 | 22505724 | |
107 | Phosphorylation | LPDTKVGSFMIRESE CCCCCCEEEEEEECC | 18.03 | 23401153 | |
110 | Ubiquitination | TKVGSFMIRESETKK CCCEEEEEEECCCCC | 4.10 | - | |
110 | Ubiquitination | TKVGSFMIRESETKK CCCEEEEEEECCCCC | 4.10 | 22505724 | |
117 | Ubiquitination | IRESETKKGFYSLSV EEECCCCCCEEEEEE | 62.77 | - | |
120 | Phosphorylation | SETKKGFYSLSVRHR CCCCCCEEEEEEEEC | 19.85 | 27642862 | |
121 | Ubiquitination | ETKKGFYSLSVRHRQ CCCCCEEEEEEEECC | 16.35 | 22505724 | |
121 | Ubiquitination | ETKKGFYSLSVRHRQ CCCCCEEEEEEEECC | 16.35 | - | |
123 | Phosphorylation | KKGFYSLSVRHRQVK CCCEEEEEEEECCCC | 15.91 | 24719451 | |
133 | Ubiquitination | HRQVKHYRIFRLPNN ECCCCEEEEEECCCC | 22.68 | 22505724 | |
143 | Phosphorylation | RLPNNWYYISPRLTF ECCCCEEEECHHHHH | 6.12 | 26074081 | |
144 | Ubiquitination | LPNNWYYISPRLTFQ CCCCEEEECHHHHHH | 2.41 | 22505724 | |
145 | Phosphorylation | PNNWYYISPRLTFQC CCCEEEECHHHHHHH | 6.45 | 26074081 | |
154 | Ubiquitination | RLTFQCLEDLVNHYS HHHHHHHHHHHHHHH | 57.85 | 29967540 | |
156 | Ubiquitination | TFQCLEDLVNHYSEV HHHHHHHHHHHHHHH | 2.80 | 22505724 | |
170 | Ubiquitination | VADGLCCVLTTPCLT HCCCEEEEEECCCCC | 5.33 | - | |
172 | Phosphorylation | DGLCCVLTTPCLTQS CCEEEEEECCCCCCC | 14.32 | 26074081 | |
173 | Phosphorylation | GLCCVLTTPCLTQST CEEEEEECCCCCCCC | 14.08 | 26074081 | |
177 | Phosphorylation | VLTTPCLTQSTAAPA EEECCCCCCCCCCCC | 27.47 | 26074081 | |
179 | Phosphorylation | TTPCLTQSTAAPAVR ECCCCCCCCCCCCCC | 18.12 | 26074081 | |
180 | Phosphorylation | TPCLTQSTAAPAVRA CCCCCCCCCCCCCCC | 19.61 | 26074081 | |
188 | Phosphorylation | AAPAVRASSSPVTLR CCCCCCCCCCCEEEE | 22.30 | 26657352 | |
189 | Phosphorylation | APAVRASSSPVTLRQ CCCCCCCCCCEEEEE | 37.36 | 28122231 | |
190 | Phosphorylation | PAVRASSSPVTLRQK CCCCCCCCCEEEEEC | 22.39 | 23401153 | |
193 | Phosphorylation | RASSSPVTLRQKTVD CCCCCCEEEEECCCC | 21.43 | 28450419 | |
197 | Ubiquitination | SPVTLRQKTVDWRRV CCEEEEECCCCHHHH | 44.04 | - | |
198 | Phosphorylation | PVTLRQKTVDWRRVS CEEEEECCCCHHHHH | 18.50 | 26074081 | |
205 | Phosphorylation | TVDWRRVSRLQEDPE CCCHHHHHHHCCCCC | 26.01 | 26074081 | |
214 | Phosphorylation | LQEDPEGTENPLGVD HCCCCCCCCCCCCCC | 30.81 | 26074081 | |
223 | Phosphorylation | NPLGVDESLFSYGLR CCCCCCHHHHHHCHH | 30.19 | 26074081 | |
225 | Ubiquitination | LGVDESLFSYGLRES CCCCHHHHHHCHHHH | 8.02 | - | |
225 | Ubiquitination | LGVDESLFSYGLRES CCCCHHHHHHCHHHH | 8.02 | 22505724 | |
226 | Phosphorylation | GVDESLFSYGLRESI CCCHHHHHHCHHHHH | 24.47 | 28122231 | |
229 | Phosphorylation | ESLFSYGLRESIASY HHHHHHCHHHHHHHH | 4.11 | 24719451 | |
230 | Phosphorylation | SLFSYGLRESIASYL HHHHHCHHHHHHHHH | 31.11 | 27251275 | |
235 | Ubiquitination | GLRESIASYLSLTSE CHHHHHHHHHHCCCC | 25.57 | - | |
235 | Ubiquitination | GLRESIASYLSLTSE CHHHHHHHHHHCCCC | 25.57 | 29967540 | |
235 | Phosphorylation | GLRESIASYLSLTSE CHHHHHHHHHHCCCC | 25.57 | - | |
237 | Ubiquitination | RESIASYLSLTSEDN HHHHHHHHHCCCCCC | 2.91 | - | |
237 | Ubiquitination | RESIASYLSLTSEDN HHHHHHHHHCCCCCC | 2.91 | 22505724 | |
238 | Phosphorylation | ESIASYLSLTSEDNT HHHHHHHHCCCCCCC | 22.74 | - | |
240 | Phosphorylation | IASYLSLTSEDNTSF HHHHHHCCCCCCCCC | 27.05 | - | |
252 | Ubiquitination | TSFDRKKKSISLMYG CCCCHHCCEEEEEEC | 56.93 | 22505724 | |
252 | Acetylation | TSFDRKKKSISLMYG CCCCHHCCEEEEEEC | 56.93 | 18585177 | |
253 | Phosphorylation | SFDRKKKSISLMYGG CCCHHCCEEEEEECC | 26.70 | 28857561 | |
255 | Phosphorylation | DRKKKSISLMYGGSK CHHCCEEEEEECCCC | 17.74 | 27251275 | |
258 | Phosphorylation | KKSISLMYGGSKRKS CCEEEEEECCCCCCC | 24.51 | 18083107 | |
261 | Phosphorylation | ISLMYGGSKRKSSFF EEEEECCCCCCCCCC | 25.56 | 24247654 | |
262 | Ubiquitination | SLMYGGSKRKSSFFS EEEECCCCCCCCCCC | 68.09 | 29967540 | |
262 | Acetylation | SLMYGGSKRKSSFFS EEEECCCCCCCCCCC | 68.09 | 18585185 | |
264 | Ubiquitination | MYGGSKRKSSFFSSP EECCCCCCCCCCCCC | 54.94 | 22505724 | |
265 | Phosphorylation | YGGSKRKSSFFSSPP ECCCCCCCCCCCCCC | 36.09 | 26074081 | |
266 | Phosphorylation | GGSKRKSSFFSSPPY CCCCCCCCCCCCCCC | 33.09 | 26074081 | |
269 | Ubiquitination | KRKSSFFSSPPYFED CCCCCCCCCCCCCCC | 39.67 | 22505724 | |
269 | Phosphorylation | KRKSSFFSSPPYFED CCCCCCCCCCCCCCC | 39.67 | 28122231 | |
270 | Phosphorylation | RKSSFFSSPPYFED- CCCCCCCCCCCCCC- | 25.41 | 26074081 | |
273 | Phosphorylation | SFFSSPPYFED---- CCCCCCCCCCC---- | 24.00 | 19605366 | |
279 | Ubiquitination | PYFED---------- CCCCC---------- | 29967540 | ||
281 | Ubiquitination | FED------------ CCC------------ | 22505724 | ||
292 | Ubiquitination | ----------------------- ----------------------- | 22505724 | ||
293 | Phosphorylation | ------------------------ ------------------------ | 27251275 | ||
301 | Phosphorylation | -------------------------------- -------------------------------- | 27251275 | ||
302 | Ubiquitination | --------------------------------- --------------------------------- | 29967540 | ||
304 | Ubiquitination | ----------------------------------- ----------------------------------- | 22505724 | ||
306 | Phosphorylation | ------------------------------------- ------------------------------------- | 24719451 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SLAP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SLAP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ZAP70_HUMAN | ZAP70 | physical | 10449770 | |
CD3Z_HUMAN | CD247 | physical | 10449770 | |
KSYK_HUMAN | SYK | physical | 10449770 | |
LAT_HUMAN | LAT | physical | 10449770 | |
EPHA2_HUMAN | EPHA2 | physical | 7543898 | |
VAV_HUMAN | VAV1 | physical | 10662792 | |
PGFRB_HUMAN | PDGFRB | physical | 18193084 | |
CBL_HUMAN | CBL | physical | 18193084 | |
FLT3_HUMAN | FLT3 | physical | 23300935 | |
EPHA2_HUMAN | EPHA2 | physical | 24457997 | |
UBE4A_HUMAN | UBE4A | physical | 24457997 | |
NCOA2_HUMAN | NCOA2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-255, AND MASSSPECTROMETRY. | |
"Phosphoproteome of resting human platelets."; Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J.,Schuetz C., Walter U., Gambaryan S., Sickmann A.; J. Proteome Res. 7:526-534(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-190, AND MASSSPECTROMETRY. |