| UniProt ID | KBZIP_HHV8P | |
|---|---|---|
| UniProt AC | Q2HR82 | |
| Protein Name | E3 SUMO-protein ligase K-bZIP | |
| Gene Name | K8 | |
| Organism | Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus). | |
| Sequence Length | 286 | |
| Subcellular Localization | ||
| Protein Description | Plays a role in viral gene regulation and seems to be essential for KSHV reactivation. Disrupts host G1 cell cycle control thus allowing viral transcription and translation to proceed at the early stages of infection. Catalyzes its own SUMO modification as well as that of its interacting partners such as host TP53 AND RB1.. | |
| Protein Sequence | MPRMKDIPTKSSPGTDNSEKDEAVIEEDLSLNGQPFFTDNTDGGENEVSWTSSLLSTYVGCQPPAIPVCETVIDLTAPSQSGAPGDEHLPCSLNAETKFHIPDPSWTLSHTPPRGPHISQQLPTRRSKRRLHRKFEEERLCTKAKQGAGRPVPASVVKVGNITPHYGEELTRGDAVPAAPITPPYPRVQRPAQPTHVLFSPVFVSLKAEVCDQSHSPTRKQGRYGRVSSKAYTRQLQQALEEKDAQLCFLAARLEAHKEQIIFLRDMLMRMCQQPASPTDAPLPPC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of KBZIP_HHV8P !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KBZIP_HHV8P !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KBZIP_HHV8P !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KBZIP_HHV8P !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HDAC1_HUMAN | HDAC1 | physical | 22416134 | |
| HDAC2_HUMAN | HDAC2 | physical | 22416134 | |
| ZN346_HUMAN | ZNF346 | physical | 25544563 | |
| RBM4B_HUMAN | RBM4B | physical | 25544563 | |
| RBM27_HUMAN | RBM27 | physical | 25544563 | |
| ZCH10_HUMAN | ZCCHC10 | physical | 25544563 | |
| CA122_HUMAN | C1orf122 | physical | 25544563 | |
| ZC21A_HUMAN | ZC2HC1A | physical | 25544563 | |
| RGL2_HUMAN | RGL2 | physical | 25544563 | |
| ZCHC9_HUMAN | ZCCHC9 | physical | 25544563 | |
| SLBP_HUMAN | SLBP | physical | 25544563 | |
| TAP26_HUMAN | CCDC59 | physical | 25544563 | |
| DDX28_HUMAN | DDX28 | physical | 25544563 | |
| KNOP1_HUMAN | KNOP1 | physical | 25544563 | |
| LN28B_HUMAN | LIN28B | physical | 25544563 | |
| PYM1_HUMAN | WIBG | physical | 25544563 | |
| HXA5_HUMAN | HOXA5 | physical | 25544563 | |
| ZC3H8_HUMAN | ZC3H8 | physical | 25544563 | |
| YETS2_HUMAN | YEATS2 | physical | 25544563 | |
| BGAL_HUMAN | GLB1 | physical | 25544563 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
