UniProt ID | ZCHC9_HUMAN | |
---|---|---|
UniProt AC | Q8N567 | |
Protein Name | Zinc finger CCHC domain-containing protein 9 | |
Gene Name | ZCCHC9 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 271 | |
Subcellular Localization | Nucleus, nucleolus . Nucleus . Expressed throughout the nucleus and concentrated mainly in the nucleolus. | |
Protein Description | May down-regulate transcription mediated by NF-kappa-B and the serum response element.. | |
Protein Sequence | MTRWARVSTTYNKRPLPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKKNKKKKEYLNEDVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRKPGHGIADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYEEILDVPKPQKPKTKIPKVVNF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MTRWARVSTTYNKRP CCCEEEEECCCCCCC | 14.96 | 25003641 | |
9 | Phosphorylation | TRWARVSTTYNKRPL CCEEEEECCCCCCCC | 30.37 | 29507054 | |
10 | Phosphorylation | RWARVSTTYNKRPLP CEEEEECCCCCCCCC | 20.00 | 25003641 | |
11 | Phosphorylation | WARVSTTYNKRPLPA EEEEECCCCCCCCCC | 20.83 | 25003641 | |
19 | Phosphorylation | NKRPLPATSWEDMKK CCCCCCCCCHHHHHC | 32.22 | 27251275 | |
20 | Phosphorylation | KRPLPATSWEDMKKG CCCCCCCCHHHHHCC | 30.49 | 27251275 | |
25 | Acetylation | ATSWEDMKKGSFEGT CCCHHHHHCCCCCCC | 67.32 | 25953088 | |
26 | Acetylation | TSWEDMKKGSFEGTS CCHHHHHCCCCCCCC | 53.82 | 11924425 | |
28 | Phosphorylation | WEDMKKGSFEGTSQN HHHHHCCCCCCCCCC | 29.07 | 25159151 | |
48 | Phosphorylation | QLEANRLSLKNDAPQ HHHHHHHHHCCCCHH | 33.78 | 25159151 | |
50 | Acetylation | EANRLSLKNDAPQAK HHHHHHHCCCCHHHH | 49.78 | 25953088 | |
83 | Phosphorylation | MEYLRQNSQMVHNGQ HHHHHHHCCCEECCE | 16.00 | - | |
173 | Sumoylation | EITKCKAKVDPALGE HHHHCCCCCCHHHCC | 32.44 | - | |
173 | Sumoylation | EITKCKAKVDPALGE HHHHCCCCCCHHHCC | 32.44 | - | |
207 | Phosphorylation | PDNPKGLYADGGGCK CCCCCCCEECCCCCC | 16.00 | 27642862 | |
218 | Phosphorylation | GGCKLCGSVEHLKKD CCCCCCCCHHHHHHH | 24.28 | 25159151 | |
243 | Acetylation | VTVGRWAKGMSADYE EEHHHHHHCCCCCHH | 48.46 | 19413330 | |
246 | Phosphorylation | GRWAKGMSADYEEIL HHHHHCCCCCHHHHH | 27.02 | 29978859 | |
249 | Phosphorylation | AKGMSADYEEILDVP HHCCCCCHHHHHCCC | 18.38 | 28796482 | |
263 | Phosphorylation | PKPQKPKTKIPKVVN CCCCCCCCCCCCCCC | 42.61 | 20860994 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZCHC9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZCHC9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZCHC9_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ZCHC9_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...