CA122_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CA122_HUMAN
• UniProt AC: Q6ZSJ8
• Protein Name: Uncharacterized protein C1orf122
• Gene Name: C1orf122
• Organism: Homo sapiens (Human).
• Sequence Length: 110
• Protein Sequence: MEWGPGSDWSRGEAAGVDRGKAGLGLGGRPPPQPPREERAQQLLDAVEQRQRQLLDTIAACEEMLRQLGRRRPEPAGGGNVSAKPGAPPQPAVSARGGFPKDAGDGAAEP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
82	Phosphorylation	PAGGGNVSAKPGAPP CCCCCCCCCCCCCCC	34.28	20068231
94	Phosphorylation	APPQPAVSARGGFPK CCCCCCCCCCCCCCC	17.85	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CA122_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CA122_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CA122_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SNX2_HUMAN	SNX2	physical	21988832

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.