UniProt ID | CDKA1_HUMAN | |
---|---|---|
UniProt AC | O14519 | |
Protein Name | Cyclin-dependent kinase 2-associated protein 1 | |
Gene Name | CDK2AP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 115 | |
Subcellular Localization | ||
Protein Description | specific inhibitor of the cell-cycle kinase CDK2.. | |
Protein Sequence | MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSYKPNLAA ------CCCCCCHHH | 41.69 | 23532336 | |
21 | Phosphorylation | AALNAAGSVHSPSTS HHHHHCCCCCCCCCC | 16.36 | 24732914 | |
24 | Phosphorylation | NAAGSVHSPSTSMAT HHCCCCCCCCCCCCC | 20.56 | 25159151 | |
26 | Phosphorylation | AGSVHSPSTSMATSS CCCCCCCCCCCCCHH | 35.81 | 24732914 | |
27 | Phosphorylation | GSVHSPSTSMATSSQ CCCCCCCCCCCCHHH | 26.38 | 25627689 | |
28 | Phosphorylation | SVHSPSTSMATSSQY CCCCCCCCCCCHHHH | 15.68 | 20068231 | |
31 | Phosphorylation | SPSTSMATSSQYRQL CCCCCCCCHHHHHHH | 21.92 | 20068231 | |
32 | Phosphorylation | PSTSMATSSQYRQLL CCCCCCCHHHHHHHH | 13.10 | 20068231 | |
33 | Phosphorylation | STSMATSSQYRQLLS CCCCCCHHHHHHHHH | 27.20 | 28634298 | |
35 | Phosphorylation | SMATSSQYRQLLSDY CCCCHHHHHHHHHHH | 11.41 | 20068231 | |
46 | Phosphorylation | LSDYGPPSLGYTQGT HHHHCCCCCCCCCCC | 37.24 | 24173317 | |
57 | Ubiquitination | TQGTGNSQVPQSKYA CCCCCCCCCCHHHHH | 55.71 | 29967540 | |
80 | Phosphorylation | LGKEIRPTYAGSKSA HHHHHCCCCCCCHHH | 19.02 | 21406692 | |
81 | Phosphorylation | GKEIRPTYAGSKSAM HHHHCCCCCCCHHHH | 16.20 | 21406692 | |
84 | Phosphorylation | IRPTYAGSKSAMERL HCCCCCCCHHHHHHH | 18.44 | 28152594 | |
85 | Ubiquitination | RPTYAGSKSAMERLK CCCCCCCHHHHHHHH | 41.12 | 29967540 | |
86 | Phosphorylation | PTYAGSKSAMERLKR CCCCCCHHHHHHHHH | 34.25 | 25072903 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
46 | S | Phosphorylation | Kinase | IKBKE | Q14164 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
46 | S | Phosphorylation |
| 22427660 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDKA1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...