CDKA2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CDKA2_HUMAN
• UniProt AC: O75956
• Protein Name: Cyclin-dependent kinase 2-associated protein 2
• Gene Name: CDK2AP2
• Organism: Homo sapiens (Human).
• Sequence Length: 126
• Subcellular Localization: Cytoplasm . Nucleus . Accumulates in immature oocytes in the nucleus. During the first meiotic division, accumulates in the cytoplasm and localizes in dots in the vicinity of the chromosomes in a region enriched in microtubules.
• Protein Description: Plays a role in regulating the self-renewal of embryonic stem cells (ESCs) and in maintaining cell survival during terminal differentiation of ESCs. Regulates microtubule organization of metaphase II oocytes (By similarity). Inhibits cell cycle G1/S phase transition by repressing CDK2 expression and activation; represses CDK2 activation by inhibiting its interaction with cyclin E and A. [PubMed: 23781148]
• Protein Sequence: MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	KPIAPAPSSTPGSST CCCCCCCCCCCCCCC	49.29	28111955
12	Phosphorylation	PIAPAPSSTPGSSTP CCCCCCCCCCCCCCC	37.25	28111955
13	Phosphorylation	IAPAPSSTPGSSTPG CCCCCCCCCCCCCCC	35.69	28111955
16	Phosphorylation	APSSTPGSSTPGPGT CCCCCCCCCCCCCCC	32.04	28111955
17	Phosphorylation	PSSTPGSSTPGPGTP CCCCCCCCCCCCCCC	44.53	28111955
18	Phosphorylation	SSTPGSSTPGPGTPV CCCCCCCCCCCCCCC	33.68	28111955
23	Phosphorylation	SSTPGPGTPVPTGSV CCCCCCCCCCCCCCC	25.01	28111955
27	Phosphorylation	GPGTPVPTGSVPSPS CCCCCCCCCCCCCCC	42.18	28111955
29	Phosphorylation	GTPVPTGSVPSPSGS CCCCCCCCCCCCCCC	33.08	28111955
32	Phosphorylation	VPTGSVPSPSGSVPG CCCCCCCCCCCCCCC	29.55	28111955
34	Phosphorylation	TGSVPSPSGSVPGAG CCCCCCCCCCCCCCC	48.30	28111955
36	Phosphorylation	SVPSPSGSVPGAGAP CCCCCCCCCCCCCCC	29.49	28111955
55	Phosphorylation	FNDFGPPSMGYVQAM CCCCCCCCCCCCEEE	28.15	27050516
91	O-linked_Glycosylation	MGKEIRPTYAGSKSA HHHHHCCCCCCCHHH	19.02	OGP
91	Phosphorylation	MGKEIRPTYAGSKSA HHHHHCCCCCCCHHH	19.02	21406692
92	Phosphorylation	GKEIRPTYAGSKSAM HHHHCCCCCCCHHHH	16.20	21406692
95	Phosphorylation	IRPTYAGSKSAMERL HCCCCCCCHHHHHHH	18.44	28152594
96	Ubiquitination	RPTYAGSKSAMERLK CCCCCCCHHHHHHHH	41.12	-
97	Phosphorylation	PTYAGSKSAMERLKR CCCCCCHHHHHHHHH	34.25	25072903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CDKA2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CDKA2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CDKA2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HSF4_HUMAN	HSF4	physical	21900206
YIF1A_HUMAN	YIF1A	physical	21900206
DREB_HUMAN	DBN1	physical	21900206
TZAP_HUMAN	ZBTB48	physical	21900206
RCC1_HUMAN	RCC1	physical	21900206
TRA2A_HUMAN	TRA2A	physical	21900206
A2MG_HUMAN	A2M	physical	21900206
RLA1_HUMAN	RPLP1	physical	21900206
IKZF1_HUMAN	IKZF1	physical	21900206
EF1G_HUMAN	EEF1G	physical	21900206
EED_HUMAN	EED	physical	21900206
MBTP1_HUMAN	MBTPS1	physical	21900206
P5CR1_HUMAN	PYCR1	physical	21900206
A4_HUMAN	APP	physical	21832049
CDKA1_HUMAN	CDK2AP1	physical	14985111
MR1L1_HUMAN	MRFAP1L1	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.