| UniProt ID | SNAI3_HUMAN | |
|---|---|---|
| UniProt AC | Q3KNW1 | |
| Protein Name | Zinc finger protein SNAI3 | |
| Gene Name | SNAI3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 292 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Seems to inhibit myoblast differentiation. Transcriptional repressor of E-box-dependent transactivation of downstream myogenic bHLHs genes. Binds preferentially to the canonical E-box sequences 5'-CAGGTG-3' and 5'-CACCTG-3' (By similarity).. | |
| Protein Sequence | MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLLARHEESGCCPGP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNAI3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNAI3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNAI3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HDAC2_HUMAN | HDAC2 | physical | 14673164 | |
| HDAC1_HUMAN | HDAC1 | physical | 14673164 | |
| SIN3A_MOUSE | Sin3a | physical | 14673164 | |
| STRN3_HUMAN | STRN3 | physical | 26186194 | |
| ZO2_HUMAN | TJP2 | physical | 26186194 | |
| STRP1_HUMAN | STRIP1 | physical | 26186194 | |
| ZO2_HUMAN | TJP2 | physical | 28514442 | |
| STRN3_HUMAN | STRN3 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...