| UniProt ID | PPARD_HUMAN | |
|---|---|---|
| UniProt AC | Q03181 | |
| Protein Name | Peroxisome proliferator-activated receptor delta | |
| Gene Name | PPARD | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 441 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand.. | |
| Protein Sequence | MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 (in isoform 3) | Phosphorylation | - | 65.36 | - | |
| 48 | Phosphorylation | SYTDLSRSSSPPSLL CCCCCCCCCCCCHHH | 31.62 | 24719451 | |
| 49 | Phosphorylation | YTDLSRSSSPPSLLD CCCCCCCCCCCHHHH | 45.84 | 26074081 | |
| 50 | Phosphorylation | TDLSRSSSPPSLLDQ CCCCCCCCCCHHHHH | 41.92 | 26074081 | |
| 53 | Phosphorylation | SRSSSPPSLLDQLQM CCCCCCCHHHHHHHC | 44.97 | 27251275 | |
| 108 | Phosphorylation | TIRMKLEYEKCERSC HHHHHHHHHHHHHHC | 30.99 | - | |
| 252 | Phosphorylation | VFYRCQCTTVETVRE EEEECCCCCHHHHHH | 14.16 | - | |
| 253 | Phosphorylation | FYRCQCTTVETVREL EEECCCCCHHHHHHH | 24.79 | - | |
| 256 | Phosphorylation | CQCTTVETVRELTEF CCCCCHHHHHHHHHH | 22.11 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 108 | Y | Phosphorylation | Kinase | EGFR | P00533 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPARD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPARD_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
