UniProt ID | STP1_HUMAN | |
---|---|---|
UniProt AC | P09430 | |
Protein Name | Spermatid nuclear transition protein 1 | |
Gene Name | TNP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 55 | |
Subcellular Localization | Nucleus . Chromosome . Loaded onto the nucleosomes of condensing spermatids. | |
Protein Description | Plays a key role in the replacement of histones to protamine in the elongating spermatids of mammals. In condensing spermatids, loaded onto the nucleosomes, where it promotes the recruitment and processing of protamines, which are responsible for histone eviction.. | |
Protein Sequence | MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | STSRKLKSHGMRRSK CHHHHHHHHCCCCCC | 35.39 | 2040274 | |
19 | Phosphorylation | MRRSKSRSPHKGVKR CCCCCCCCCCCCCCC | 38.15 | 24719451 | |
40 | Phosphorylation | YRKGNLKSRKRGDDA CCCCCCCCCCCCCCC | 46.32 | 8019440 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PPARG_HUMAN | PPARG | physical | 21967852 | |
SDCB2_HUMAN | SDCBP2 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...