STP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: STP1_HUMAN
• UniProt AC: P09430
• Protein Name: Spermatid nuclear transition protein 1
• Gene Name: TNP1
• Organism: Homo sapiens (Human).
• Sequence Length: 55
• Subcellular Localization: Nucleus . Chromosome . Loaded onto the nucleosomes of condensing spermatids.
• Protein Description: Plays a key role in the replacement of histones to protamine in the elongating spermatids of mammals. In condensing spermatids, loaded onto the nucleosomes, where it promotes the recruitment and processing of protamines, which are responsible for histone eviction..
• Protein Sequence: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	STSRKLKSHGMRRSK CHHHHHHHHCCCCCC	35.39	2040274
19	Phosphorylation	MRRSKSRSPHKGVKR CCCCCCCCCCCCCCC	38.15	24719451
40	Phosphorylation	YRKGNLKSRKRGDDA CCCCCCCCCCCCCCC	46.32	8019440

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of STP1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of STP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of STP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PPARG_HUMAN	PPARG	physical	21967852
SDCB2_HUMAN	SDCBP2	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.