UniProt ID | CP087_HUMAN | |
---|---|---|
UniProt AC | Q6PH81 | |
Protein Name | UPF0547 protein C16orf87 | |
Gene Name | C16orf87 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 154 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSATRAKKVKMATKSCPECDQQVPVACKSCPCGYIFISRKLLNAKHSEKSPPSTENKHEAKRRRTERVRREKINSTVNKDLENRKRSRSNSHSDHIRRGRGRPKSASAKKHEEEREKQEKEIDIYANLSDEKAFVFSVALAEINRKIINQRLIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Acetylation | SRKLLNAKHSEKSPP EHHHHHCCCCCCCCC | 46.74 | 24847271 | |
47 | Phosphorylation | KLLNAKHSEKSPPST HHHHCCCCCCCCCCC | 46.11 | 26657352 | |
49 | Acetylation | LNAKHSEKSPPSTEN HHCCCCCCCCCCCCC | 71.87 | 24847283 | |
50 | Phosphorylation | NAKHSEKSPPSTENK HCCCCCCCCCCCCCH | 37.68 | 21955146 | |
53 | Phosphorylation | HSEKSPPSTENKHEA CCCCCCCCCCCHHHH | 52.30 | 23663014 | |
54 | Phosphorylation | SEKSPPSTENKHEAK CCCCCCCCCCHHHHH | 49.72 | 23663014 | |
72 | Ubiquitination | TERVRREKINSTVNK HHHHHHHHHHHHHCH | 45.43 | 24816145 | |
89 | Phosphorylation | ENRKRSRSNSHSDHI HHHHHHCCCCCHHHH | 43.88 | 20363803 | |
91 | Phosphorylation | RKRSRSNSHSDHIRR HHHHCCCCCHHHHHH | 26.14 | 26657352 | |
93 | Phosphorylation | RSRSNSHSDHIRRGR HHCCCCCHHHHHHCC | 30.61 | 21406692 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CP087_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CP087_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CP087_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MIER3_HUMAN | MIER3 | physical | 28514442 | |
ANC2_HUMAN | ANAPC2 | physical | 28514442 | |
MIER1_HUMAN | MIER1 | physical | 28514442 | |
CDC16_HUMAN | CDC16 | physical | 28514442 | |
ARI5B_HUMAN | ARID5B | physical | 28514442 | |
NEK2_HUMAN | NEK2 | physical | 28514442 | |
APC4_HUMAN | ANAPC4 | physical | 28514442 | |
CDC23_HUMAN | CDC23 | physical | 28514442 | |
CDC27_HUMAN | CDC27 | physical | 28514442 | |
MIER2_HUMAN | MIER2 | physical | 28514442 | |
HDAC1_HUMAN | HDAC1 | physical | 28514442 | |
APC5_HUMAN | ANAPC5 | physical | 28514442 | |
APC1_HUMAN | ANAPC1 | physical | 28514442 | |
FZR1_HUMAN | FZR1 | physical | 28514442 | |
APC7_HUMAN | ANAPC7 | physical | 28514442 | |
APC16_HUMAN | ANAPC16 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...