| UniProt ID | OVOL1_HUMAN | |
|---|---|---|
| UniProt AC | O14753 | |
| Protein Name | Putative transcription factor Ovo-like 1 | |
| Gene Name | OVOL1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 267 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Putative transcription factor. Involved in hair formation and spermatogenesis. May function in the differentiation and/or maintenance of the urogenital system (By similarity).. | |
| Protein Sequence | MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 103 | Phosphorylation | RDHGFLRTKMKVTLG CCCCCEEEEEEEEEC | 37.32 | - | |
| 108 | Phosphorylation | LRTKMKVTLGDSPSG EEEEEEEEECCCCCC | 21.36 | - | |
| 112 | Phosphorylation | MKVTLGDSPSGDLFT EEEEECCCCCCCEEE | 21.11 | 28348404 | |
| 114 | Phosphorylation | VTLGDSPSGDLFTCR EEECCCCCCCEEEHH | 49.22 | - | |
| 119 | Phosphorylation | SPSGDLFTCRVCQKA CCCCCEEEHHHHHHH | 13.49 | - | |
| 239 | Phosphorylation | LKEHHPDSPLLRKTS EHHHCCCCHHHHHHC | 23.15 | 24719451 | |
| 258 | Phosphorylation | VALQNTVTSLLQGSP HHHHHHHHHHHCCCC | 16.18 | 28348404 | |
| 264 | Phosphorylation | VTSLLQGSPHL---- HHHHHCCCCCC---- | 9.00 | 28348404 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OVOL1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OVOL1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OVOL1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HDAC1_HUMAN | HDAC1 | physical | 17311813 | |
| HDAC2_HUMAN | HDAC2 | physical | 17311813 | |
| HDAC3_HUMAN | HDAC3 | physical | 17311813 | |
| SUFU_HUMAN | SUFU | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
