| UniProt ID | IFT20_HUMAN | |
|---|---|---|
| UniProt AC | Q8IY31 | |
| Protein Name | Intraflagellar transport protein 20 homolog | |
| Gene Name | IFT20 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 132 | |
| Subcellular Localization | Golgi apparatus, cis-Golgi network . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole . Cytoplasm, cytoskeleton, cilium basal body . Cell projection, cilium . Present at the centrosomes during the cell cycle and associate | |
| Protein Description | Part of intraflagellar transport (IFT) particles involved in ciliary process assembly. May play a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium. Also involved in autophagy since it is required for trafficking of ATG16L and the expansion of the autophagic compartment.. | |
| Protein Sequence | MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 18 | Ubiquitination | LHFDELNKLRVLDPE CCHHHHCCCCCCCHH | 50.74 | - | |
| 27 | Phosphorylation | RVLDPEVTQQTIELK CCCCHHHHHHHHHHH | 17.19 | 20068231 | |
| 30 | Phosphorylation | DPEVTQQTIELKEEC CHHHHHHHHHHHHHH | 13.45 | 20068231 | |
| 34 | Ubiquitination | TQQTIELKEECKDFV HHHHHHHHHHHHHHH | 38.38 | - | |
| 100 | Ubiquitination | LQALIAEKKMQLERY HHHHHHHHHHHHHHH | 44.52 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFT20_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFT20_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFT20_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| IMA1_HUMAN | KPNA2 | physical | 21988832 | |
| BL1S6_HUMAN | BLOC1S6 | physical | 21988832 | |
| HAUS1_HUMAN | HAUS1 | physical | 25416956 | |
| FSD2_HUMAN | FSD2 | physical | 25416956 | |
| DEUP1_HUMAN | CCDC67 | physical | 25416956 | |
| IF172_HUMAN | IFT172 | physical | 27173435 | |
| IFT57_HUMAN | IFT57 | physical | 27173435 | |
| IFT74_HUMAN | IFT74 | physical | 27173435 | |
| IFT46_HUMAN | IFT46 | physical | 27173435 | |
| IFT22_HUMAN | IFT22 | physical | 27173435 | |
| IFT52_HUMAN | IFT52 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...