| UniProt ID | IFT46_HUMAN | |
|---|---|---|
| UniProt AC | Q9NQC8 | |
| Protein Name | Intraflagellar transport protein 46 homolog | |
| Gene Name | IFT46 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 304 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, cilium basal body. Cell projection, cilium. Expression is concentrated at the cilium basal body but is also detected along the length of the cilium.. | |
| Protein Description | Forms part of a complex involved in intraflagellar transport (IFT), the bi-directional movement of particles required for the assembly, maintenance and functioning of primary cilia. May play a role in chondrocyte maturation and skeletogenesis (By similarity).. | |
| Protein Sequence | MADNSSDECEEENNKEKKKTSQLTPQRGFSENEDDDDDDDDSSETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLVLDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEELLGKVSLPTAEIDCSLAEYIDMICAILDIPVYKSRIQSLHLLFSLYSEFKNSQHFKALAEGKKAFTPSSNSTSQAGDMETLTFS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MADNSSDECEEE ---CCCCCHHHHHHH | 39.45 | 25850435 | |
| 5 (in isoform 2) | Phosphorylation | - | 39.45 | 24719451 | |
| 6 | Phosphorylation | --MADNSSDECEEEN --CCCCCHHHHHHHH | 43.62 | 25850435 | |
| 6 (in isoform 2) | Phosphorylation | - | 43.62 | 24719451 | |
| 20 | Phosphorylation | NNKEKKKTSQLTPQR HHHHHHHHHHCCCCC | 30.50 | 27794612 | |
| 24 | Phosphorylation | KKKTSQLTPQRGFSE HHHHHHCCCCCCCCC | 15.11 | 27732954 | |
| 61 | Phosphorylation | EEHGAPLEGAYDPAD HHCCCCCCCCCCHHH | 40.49 | 27251275 | |
| 61 (in isoform 2) | Phosphorylation | - | 40.49 | 28348404 | |
| 100 | Ubiquitination | IDLDHKLKPFIPDFI CCCCHHCCCCCCCCC | 42.56 | - | |
| 125 | Ubiquitination | KVPRPDGKPDNLGLL CCCCCCCCCCCEEEE | 57.49 | - | |
| 192 | Phosphorylation | SISELHRSKPPATVH HHHHHHHCCCCCEEE | 38.47 | 24719451 | |
| 200 | Phosphorylation | KPPATVHYTRPMPDI CCCCEEEECCCCCCH | 10.50 | 24719451 | |
| 282 | 2-Hydroxyisobutyrylation | FKALAEGKKAFTPSS HHHHHCCCCCCCCCC | 32.22 | - | |
| 286 | Phosphorylation | AEGKKAFTPSSNSTS HCCCCCCCCCCCCCC | 27.41 | 16674116 | |
| 288 | Phosphorylation | GKKAFTPSSNSTSQA CCCCCCCCCCCCCCC | 38.81 | 16674116 | |
| 302 | Phosphorylation | AGDMETLTFS----- CCCCCEECCC----- | 29.29 | 16674116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFT46_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFT46_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFT46_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| IFT88_HUMAN | IFT88 | physical | 22939629 | |
| UBX10_HUMAN | UBXN10 | physical | 26389662 | |
| IFT74_HUMAN | IFT74 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...