HSBP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HSBP1_HUMAN
• UniProt AC: O75506
• Protein Name: Heat shock factor-binding protein 1
• Gene Name: HSBP1
• Organism: Homo sapiens (Human).
• Sequence Length: 76
• Subcellular Localization: Nucleus.
• Protein Description: Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process..
• Protein Sequence: MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MAETDPKTVQDLTSV CCCCCHHHHHHHHHH	28.87	-
30	Sulfoxidation	MQDKFQTMSDQIIGR HHHHHHHHHHHHHHH	2.64	21406390
50	Ubiquitination	SRIDDLEKNIADLMT HHHHHHHHHHHHHHH	62.03	21906983
51	Ubiquitination	RIDDLEKNIADLMTQ HHHHHHHHHHHHHHH	25.88	21906983
57	Phosphorylation	KNIADLMTQAGVEEL HHHHHHHHHHCHHHH	23.67	28122231
66	O-linked_Glycosylation	AGVEELESENKIPAT HCHHHHHHCCCCCCC	60.12	28657654
66	Phosphorylation	AGVEELESENKIPAT HCHHHHHHCCCCCCC	60.12	22199227
69	Ubiquitination	EELESENKIPATQKS HHHHHCCCCCCCCCC	46.12	6983
70	Ubiquitination	ELESENKIPATQKS- HHHHCCCCCCCCCC-	4.18	21906983
73	O-linked_Glycosylation	SENKIPATQKS---- HCCCCCCCCCC----	31.04	28657654
73	Phosphorylation	SENKIPATQKS---- HCCCCCCCCCC----	31.04	22199227
75	Acetylation	NKIPATQKS------ CCCCCCCCC------	54.50	25953088
75	Ubiquitination	NKIPATQKS------ CCCCCCCCC------	54.50	33845483
76	Phosphorylation	KIPATQKS------- CCCCCCCC-------	35.32	30278072
76	Ubiquitination	KIPATQKS------- CCCCCCCC-------	35.32	21906983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HSBP1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HSBP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HSBP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
WASC3_HUMAN	CCDC53	physical	16189514
HSBP1_HUMAN	HSBP1	physical	11679589
HSP74_HUMAN	HSPA4	physical	9649501
HSF1_HUMAN	HSF1	physical	9649501
RRBP1_HUMAN	RRBP1	physical	22939629
HSBP1_HUMAN	HSBP1	physical	25416956
KIFC3_HUMAN	KIFC3	physical	25416956
SDCB1_HUMAN	SDCBP	physical	25416956
WASC3_HUMAN	CCDC53	physical	25416956
CCHCR_HUMAN	CCHCR1	physical	25416956
SKT_HUMAN	KIAA1217	physical	25416956
LNX1_HUMAN	LNX1	physical	25416956
KR107_HUMAN	KRTAP10-7	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.