IR3IP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IR3IP_HUMAN
• UniProt AC: Q9Y5U9
• Protein Name: Immediate early response 3-interacting protein 1
• Gene Name: IER3IP1 {ECO:0000312|HGNC:HGNC:18550}
• Organism: Homo sapiens (Human).
• Sequence Length: 82
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: May be implicated in the regulation of apoptosis. May be involved in protein transport between endoplasmic reticulum and Golgi apparatus (By similarity)..
• Protein Sequence: MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
29	Ubiquitination	LHEERFLKNIGWGTD HCHHHHHHHCCCCCC	43.75	23000965
49	Ubiquitination	FGEEPGIKSQLMNLI CCCCCCHHHHHHHHH	37.76	21906983
50	Phosphorylation	GEEPGIKSQLMNLIR CCCCCHHHHHHHHHH	26.99	20068231

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IR3IP_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IR3IP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IR3IP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VP13C_HUMAN	VPS13C	physical	28514442
GBG5_HUMAN	GNG5	physical	28514442
ADCY9_HUMAN	ADCY9	physical	28514442
PTPRG_HUMAN	PTPRG	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 614231: Microcephaly, epilepsy, and diabetes syndrome (MEDS)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.