UniProt ID | IR3IP_HUMAN | |
---|---|---|
UniProt AC | Q9Y5U9 | |
Protein Name | Immediate early response 3-interacting protein 1 | |
Gene Name | IER3IP1 {ECO:0000312|HGNC:HGNC:18550} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 82 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | May be implicated in the regulation of apoptosis. May be involved in protein transport between endoplasmic reticulum and Golgi apparatus (By similarity).. | |
Protein Sequence | MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Ubiquitination | LHEERFLKNIGWGTD HCHHHHHHHCCCCCC | 43.75 | 23000965 | |
49 | Ubiquitination | FGEEPGIKSQLMNLI CCCCCCHHHHHHHHH | 37.76 | 21906983 | |
50 | Phosphorylation | GEEPGIKSQLMNLIR CCCCCHHHHHHHHHH | 26.99 | 20068231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IR3IP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IR3IP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IR3IP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VP13C_HUMAN | VPS13C | physical | 28514442 | |
GBG5_HUMAN | GNG5 | physical | 28514442 | |
ADCY9_HUMAN | ADCY9 | physical | 28514442 | |
PTPRG_HUMAN | PTPRG | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
614231 | Microcephaly, epilepsy, and diabetes syndrome (MEDS) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...